Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T11451
|
||||
| Former ID |
TTDC00107
|
||||
| Target Name |
Toll-like receptor 9
|
||||
| Gene Name |
TLR9
|
||||
| Synonyms |
TLR-9; TLR9
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | |||||
| Asthma; Allergy [ICD9: 204.0, 493, 995.3; ICD10: C91.0, J45, T78.4] | |||||
| Autoimmune diabetes [ICD10: E08-E13] | |||||
| Bacillus anthracis infection [ICD10: A22] | |||||
| Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Diffuse large B-cell lymphoma [ICD9: 200; ICD10: C83.3] | |||||
| Glioblastoma multiforme [ICD9: 191; ICD10: C71] | |||||
| HCV infection [ICD9: 070.4, 070.5, 070.70; ICD10: B17.1, B18.2] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| HBV infection [ICD9: 070.2-070.3; ICD10: B16, B18.0, B18.1] | |||||
| Infections [ICD9: 001-139; ICD10: A00-B99] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Influenza virus [ICD10: J11.1] | |||||
| Lung cancer [ICD9: 162; ICD10: C33-C34] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Renal cell carcinoma; Solid tumours [ICD9: 140-199, 189, 210-229; ICD10: C00-C75, C64, C7A, C7B, D10-D36, D3A] | |||||
| Systemic lupus erythematosus [ICD9: 710; ICD10: M32] | |||||
| Function |
Participates in the innate immune response to microbial agents. Detects the unmethylated cytidine-phosphate-guanosine (cpg) motivs present in bacterial dna. Acts via myd88 and traf6, leading to nf-kappa-b activation, cytokine secretion andthe inflammatory process.
|
||||
| BioChemical Class |
Toll-like receptor family
|
||||
| Target Validation |
T11451
|
||||
| UniProt ID | |||||
| Sequence |
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF YNRNFCQGPTAE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cadi-05 | Drug Info | Phase 3 | Prostate cancer | [522525] |
| MGN-1703 | Drug Info | Phase 3 | Colorectal cancer | [524663] | |
| SD-101 | Drug Info | Phase 3 | HCV infection | [525113] | |
| BL-7040 | Drug Info | Phase 2 | Inflammatory bowel disease | [523753] | |
| CpG-10101 | Drug Info | Phase 2 | HCV infection | [521786] | |
| CYT003 | Drug Info | Phase 2 | Asthma | [533260] | |
| IMO-2055 | Drug Info | Phase 2 | Renal cell carcinoma; Solid tumours | [550998] | |
| JVRS-100 | Drug Info | Phase 2 | Leukemia | [522718] | |
| MIS-416 | Drug Info | Phase 2 | Autoimmune diabetes | [549949] | |
| Tolamba | Drug Info | Phase 2 | Allergic rhinitis | [522129] | |
| Zadaxin/lamivudine | Drug Info | Phase 2 | HBV infection | [549869] | |
| AZD1419 | Drug Info | Phase 1 | Asthma | [548372] | |
| CPG 52364 | Drug Info | Phase 1 | Systemic lupus erythematosus | [532501] | |
| GNKG-168 | Drug Info | Phase 1 | Chronic lymphocytic leukaemia | [524153] | |
| IMO-2125 | Drug Info | Phase 1 | HCV infection | [550998] | |
| IMO-3100 | Drug Info | Phase 1 | Autoimmune diabetes | [550998] | |
| Litenimod | Drug Info | Phase 1 | Glioblastoma multiforme | [551464] | |
| MGN-1706 | Drug Info | Phase 1 | Cancer | [525374] | |
| N-8295 | Drug Info | Phase 1 | Influenza virus | [549878] | |
| SAR-21609 | Drug Info | Phase 1 | Asthma | [530837] | |
| IMO-2134 | Drug Info | Preclinical | Asthma; Allergy | [550998] | |
| IR-103 | Drug Info | Discontinued in Phase 3 | Human immunodeficiency virus infection | [547777] | |
| Agatolimod | Drug Info | Discontinued in Phase 2 | Lung cancer | [547005] | |
| IM0-8400 | Drug Info | Discontinued in Phase 1/2 | Diffuse large B-cell lymphoma | [550999] | |
| DV-1179 | Drug Info | Discontinued in Phase 1 | Systemic lupus erythematosus | [549321] | |
| AVE0675 | Drug Info | Terminated | Asthma | [548655] | |
| Agonist | Agatolimod | Drug Info | [536475], [549974] | ||
| AVE0675 | Drug Info | [549823] | |||
| AZD1419 | Drug Info | [549879] | |||
| CpG-10101 | Drug Info | [528995] | |||
| CYT003 | Drug Info | [533260] | |||
| IMO-2055 | Drug Info | [550998] | |||
| IMO-2125 | Drug Info | [550998] | |||
| IMO-2134 | Drug Info | [550998] | |||
| MGN-1703 | Drug Info | [532775] | |||
| MGN-1706 | Drug Info | [543477] | |||
| SAR-21609 | Drug Info | [544251] | |||
| Activator | BL-7040 | Drug Info | [533251] | ||
| Antagonist | CPG 52364 | Drug Info | [551089] | ||
| IM0-8400 | Drug Info | [551000] | |||
| Modulator | DIMS-9054 | Drug Info | [543477] | ||
| DV-1179 | Drug Info | ||||
| GNKG-168 | Drug Info | [550450] | |||
| IMO-3100 | Drug Info | ||||
| Litenimod | Drug Info | [543477] | |||
| MIS-416 | Drug Info | ||||
| Zadaxin/lamivudine | Drug Info | [527615] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Toll-like receptor signaling pathway | ||||
| Chagas disease (American trypanosomiasis) | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Tuberculosis | |||||
| Measles | |||||
| Herpes simplex infection | |||||
| NetPath Pathway | BCR Signaling Pathway | ||||
| PANTHER Pathway | Toll receptor signaling pathway | ||||
| Reactome | PI3K Cascade | ||||
| Trafficking and processing of endosomal TLR | |||||
| TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling | |||||
| TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation | |||||
| MyD88 dependent cascade initiated on endosome | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Toll-Like Receptors Cascades | |||||
| MyD88 dependent cascade initiated on endosome | |||||
| Trafficking and processing of endosomal TLR | |||||
| Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| Ref 521786 | ClinicalTrials.gov (NCT00277238) CPG10101 Combination Therapy For The Treatment Of Hepatitis C In Non-Responder (Null And Partial Responder) Hepatitis C Virus (HCV) Genotype 1 Infected Subjects. U.S.National Institutes of Health. | ||||
| Ref 522129 | ClinicalTrials.gov (NCT00537355) An Evaluation of the Efficacy and Safety of TOLAMBA for Ragweed-Allergic Rhinitis in an Environmental Exposure Chamber. U.S. National Institutes of Health. | ||||
| Ref 522525 | ClinicalTrials.gov (NCT00810849) A Trial of Adjunctive Prednisolone and Mycobacterium w Immunotherapy in Tuberculous Pericarditis. U.S. National Institutes of Health. | ||||
| Ref 522718 | ClinicalTrials.gov (NCT00936468) Safety, Tolerability and Immunogenicity of Fluzone With and Without JVRS-100 in Elderly Subjects. U.S. National Institutes of Health. | ||||
| Ref 523753 | ClinicalTrials.gov (NCT01506362) Efficacy, Pharmacodynamics, Safety and Tolerability of Oral BL-7040 in Patients With Moderately Active Ulcerative Colitis. U.S. National Institutes of Health. | ||||
| Ref 524153 | ClinicalTrials.gov (NCT01743807) Phase I Study of GNKG168 in Acute Lymphoblastic Leukemia and Acute Myelogenous Leukemia. U.S. National Institutes of Health. | ||||
| Ref 524663 | ClinicalTrials.gov (NCT02077868) Evaluation of MGN1703 Maintenance Treatment in Patients With mCRC With Tumor Reduction During Induction Treatment. U.S. National Institutes of Health. | ||||
| Ref 525113 | ClinicalTrials.gov (NCT02384460) Study of Efficacy and Safety of SD-101 Cream in Patients With Epidermolysis Bullosa. U.S. National Institutes of Health. | ||||
| Ref 525374 | Targeting Toll-like receptors: emerging therapeutics? Nat Rev Drug Discov. 2010 Apr;9(4):293-307. doi: 10.1038/nrd3203. | ||||
| Ref 530837 | Targeting Toll-like receptors: emerging therapeutics. Nat Rev Drug Discov. 2010 Apr;9(4):293-307. | ||||
| Ref 532501 | Treatment of systemic lupus erythematosus: new therapeutic avenues and blind alleys. Nat Rev Rheumatol. 2014 Jan;10(1):23-34. | ||||
| Ref 533260 | CYT003, a TLR9 agonist, in persistent allergic asthma - a randomized placebo-controlled Phase 2b study. Allergy. 2015 Sep;70(9):1160-8. | ||||
| Ref 547005 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011959) | ||||
| Ref 547777 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019204) | ||||
| Ref 548372 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025034) | ||||
| Ref 548655 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027402) | ||||
| Ref 549321 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035150) | ||||
| Ref 549949 | Targeting Innate Receptors with MIS416 Reshapes Th Responses and Suppresses CNS Disease in a Mouse Model of Multiple Sclerosis. PLoS ONE 9(1): e87712. January 31, 2014. | ||||
| Ref 527615 | Zadaxin (thymosin alpha1) for the treatment of viral hepatitis. Expert Opin Investig Drugs. 1999 Mar;8(3):281-7. | ||||
| Ref 528995 | Safety, pharmacokinetics and immune effects in normal volunteers of CPG 10101 (ACTILON), an investigational synthetic toll-like receptor 9 agonist. Antivir Ther. 2007;12(5):741-51. | ||||
| Ref 532775 | Maintenance treatment with the immunomodulator MGN1703, a Toll-like receptor 9 (TLR9) agonist, in patients with metastatic colorectal carcinoma and disease control after chemotherapy: a randomised, double-blind, placebo-controlled trial. J Cancer Res Clin Oncol. 2014 Sep;140(9):1615-24. | ||||
| Ref 533251 | Gut feeling: MicroRNA discriminators of the intestinal TLR9-cholinergic links. Int Immunopharmacol. 2015 May 20. pii: S1567-5769(15)00231-3. | ||||
| Ref 533260 | CYT003, a TLR9 agonist, in persistent allergic asthma - a randomized placebo-controlled Phase 2b study. Allergy. 2015 Sep;70(9):1160-8. | ||||
| Ref 536475 | CPG-7909 (PF-3512676, ProMune): toll-like receptor-9 agonist in cancer therapy. Expert Opin Biol Ther. 2007 Aug;7(8):1257-66. | ||||
| Ref 543477 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1759). | ||||
| Ref 544078 | Cationic lipid/DNA complexes (JVRS-100) combined with influenza vaccine (Fluzone?) increases antibody response, cellular immunity, and antigenically drifted protection. Vaccine. 2009 June 12; 27(29):3811-3820. | ||||
| Ref 544095 | Phase II study of a TLR-9 agonist (1018 ISS) with rituximab in patients with relapsed or refractory follicular lymphoma. Br J Haematol. 2009 August; 146(3): 282-291. | ||||
| Ref 544251 | Trial Watch: Experimental Toll-like receptor agonists for cancer therapy. Oncoimmunology. 2012 August 1; 1(5): 699-716. | ||||
| Ref 544459 | Novel drugs targeting Toll-like receptors for antiviral therapy. Future Virol. 2014 September; 9(9): 811-829. | ||||
| Ref 547845 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019871) | ||||
| Ref 549949 | Targeting Innate Receptors with MIS416 Reshapes Th Responses and Suppresses CNS Disease in a Mouse Model of Multiple Sclerosis. PLoS ONE 9(1): e87712. January 31, 2014. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

