General Information of DME (ID: DME0135)
DME Name Cytochrome P450 4F12 (CYP4F12), Homo sapiens
Synonyms Cytochrome P450 family 4 subfamily F member 12; CYP4F12; CYPIVF12; UNQ568/PRO1129
Gene Name CYP4F12
UniProt ID
CP4FC_HUMAN
Gene ID
66002
EC Number    EC: 1.14.14.1     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF
WGHLGLITPTEEGLKNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPK
DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH
LASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL
QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID
VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC
LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ
Pathway Fatty acids (R-HSA-211935 )
Eicosanoids (R-HSA-211979 )
Function This enzyme is involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs). It catalyzes the hydroxylation of carbon hydrogen bonds, with preference for omega-2 position and Metabolizes (5Z,8Z,11Z,14Z)- eicosatetraenoic acid (arachidonate) toward 18-hydroxy arachidonate. Besides, it catalyzes the epoxidation of double bonds of PUFAs such as docosapentaenoic and docosahexaenoic acids. It is also involved in the metabolism of xenobiotics and catalyzes the hydroxylation of the antihistamine drug ebastine.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          4 Drugs
Ponesimod
Drug Info Approved Multiple sclerosis ICD11: 8A40 [1]
Ponesimod
Drug Info Approved Multiple sclerosis ICD11: 8A40 [2]
Fingolimod
Drug Info Approved Multiple sclerosis ICD11: 8A40 [3]
Fingolimod hydrochloride
Drug Info Approved Multiple sclerosis ICD11: 8A40 [3]
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Ebastine
Drug Info Phase 4 Irritable bowel syndrome ICD11: DD91 [4]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Omecamtiv mecarbil
Drug Info Phase 3 Heart failure ICD11: BD10-BD1Z [5]
      Drugs in Phase 2 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
MT-1303
Drug Info Phase 2 Crohn disease ICD11: DD70 [6]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR012335 MT-1303 HU10 Unclear - Unclear MT-1303 [6]
MR012109 Omecamtiv mecarbil Omecamtiv mecarbil Metabolites M3 Unclear - Unclear Omecamtiv mecarbil [5]
MR013198 Ponesimod Ponesimod M12 Metabolite (ACT-204426) Oxidation - Oxidationn Ponesimod [1]
Tissue/Disease-Specific Protein Abundances of This DME
      Tissue-specific Protein Abundances in Healthy Individuals Click to Show/Hide
      ICD Disease Classification 01 Infectious/parasitic disease Click to Show/Hide
                  ICD-11: 1C1H     Necrotising ulcerative gingivitis Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.94E-06; Fold-change: -2.81E-01; Z-score: -7.46E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1E30     Influenza Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.20E-03; Fold-change: 7.71E-01; Z-score: 4.95E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1E51     Chronic viral hepatitis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.96E-01; Fold-change: 3.23E-02; Z-score: 1.88E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1G41     Sepsis with septic shock Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.59E-02; Fold-change: 1.17E-01; Z-score: 2.45E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA40     Respiratory syncytial virus infection Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.68E-01; Fold-change: -7.51E-02; Z-score: -3.85E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA42     Rhinovirus infection Click to Show/Hide
The Studied Tissue     Nasal epithelium tissue
The Specified Disease     Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.22E-02; Fold-change: -6.69E-02; Z-score: -2.73E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: KA60     Neonatal sepsis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.17E-06; Fold-change: 2.09E-01; Z-score: 4.04E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 02 Neoplasm Click to Show/Hide
                  ICD-11: 2A00     Brain cancer Click to Show/Hide
The Studied Tissue     Nervous tissue
The Specified Disease     Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.07E-23; Fold-change: -3.14E-01; Z-score: -5.86E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Brain stem tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.78E-05; Fold-change: 3.41E-01; Z-score: 6.83E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     White matter tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.93E-01; Fold-change: -2.14E-01; Z-score: -7.99E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Brain stem tissue
The Specified Disease     Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.96E-08; Fold-change: -2.41E+00; Z-score: -5.58E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A20     Myeloproliferative neoplasm Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.80E-01; Fold-change: -6.12E-02; Z-score: -2.80E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.45E-02; Fold-change: 9.35E-02; Z-score: 5.12E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A36     Myelodysplastic syndrome Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.63E-01; Fold-change: -4.78E-02; Z-score: -1.95E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 9.00E-01; Fold-change: 4.28E-02; Z-score: 1.33E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A81     Diffuse large B-cell lymphoma Click to Show/Hide
The Studied Tissue     Tonsil tissue
The Specified Disease     Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.76E-01; Fold-change: -9.40E-02; Z-score: -3.34E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A83     Plasma cell neoplasm Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.72E-01; Fold-change: 5.31E-02; Z-score: 2.54E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Bone marrow
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.10E-03; Fold-change: -2.30E-01; Z-score: -1.40E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B33     Leukaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.10E-03; Fold-change: -5.16E-02; Z-score: -2.09E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B6E     Oral cancer Click to Show/Hide
The Studied Tissue     Oral tissue
The Specified Disease     Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.15E-12; Fold-change: -1.60E+00; Z-score: -2.11E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.57E-50; Fold-change: -1.54E+00; Z-score: -2.99E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B70     Esophageal cancer Click to Show/Hide
The Studied Tissue     Esophagus
The Specified Disease     Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.97E-02; Fold-change: -6.91E-01; Z-score: -1.23E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B72     Stomach cancer Click to Show/Hide
The Studied Tissue     Gastric tissue
The Specified Disease     Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.11E-01; Fold-change: -1.51E+00; Z-score: -2.11E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 8.23E-05; Fold-change: -8.57E-01; Z-score: -1.47E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B90     Colon cancer Click to Show/Hide
The Studied Tissue     Colon tissue
The Specified Disease     Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.37E-78; Fold-change: -1.30E+00; Z-score: -2.65E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.05E-52; Fold-change: -1.21E+00; Z-score: -2.22E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B92     Rectal cancer Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.36E-03; Fold-change: -5.23E-01; Z-score: -1.76E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.35E-05; Fold-change: -8.10E-01; Z-score: -3.41E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C10     Pancreatic cancer Click to Show/Hide
The Studied Tissue     Pancreas
The Specified Disease     Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.22E-01; Fold-change: -8.35E-02; Z-score: -1.14E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.49E-02; Fold-change: -4.30E-01; Z-score: -4.95E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C12     Liver cancer Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.97E-14; Fold-change: -1.02E+00; Z-score: -1.64E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.50E-50; Fold-change: -8.68E-01; Z-score: -1.58E+00
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 8.31E-03; Fold-change: -8.75E-01; Z-score: -2.84E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C25     Lung cancer Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.61E-13; Fold-change: -2.01E-01; Z-score: -4.44E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.15E-21; Fold-change: -3.30E-01; Z-score: -8.66E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C30     Skin cancer Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.29E-04; Fold-change: -8.99E-01; Z-score: -7.05E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Skin
The Specified Disease     Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.51E-97; Fold-change: -1.98E+00; Z-score: -3.00E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.83E-68; Fold-change: -1.39E+00; Z-score: -2.17E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C6Z     Breast cancer Click to Show/Hide
The Studied Tissue     Breast tissue
The Specified Disease     Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.50E-46; Fold-change: -4.66E-01; Z-score: -1.15E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.23E-07; Fold-change: -3.36E-01; Z-score: -5.97E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C73     Ovarian cancer Click to Show/Hide
The Studied Tissue     Ovarian tissue
The Specified Disease     Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.75E-02; Fold-change: -2.08E-01; Z-score: -6.76E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.90E-02; Fold-change: -1.75E-01; Z-score: -1.77E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C77     Cervical cancer Click to Show/Hide
The Studied Tissue     Cervical tissue
The Specified Disease     Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.21E-04; Fold-change: -5.32E-01; Z-score: -1.11E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C78     Uterine cancer Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.10E-07; Fold-change: 1.14E+00; Z-score: 1.17E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.22E-02; Fold-change: 1.04E+00; Z-score: 1.45E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C82     Prostate cancer Click to Show/Hide
The Studied Tissue     Prostate
The Specified Disease     Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.76E-07; Fold-change: -1.60E+00; Z-score: -1.77E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C90     Renal cancer Click to Show/Hide
The Studied Tissue     Kidney
The Specified Disease     Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.49E-06; Fold-change: -1.08E+00; Z-score: -2.60E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 3.69E-21; Fold-change: -1.27E+00; Z-score: -1.90E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C92     Ureter cancer Click to Show/Hide
The Studied Tissue     Urothelium
The Specified Disease     Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.98E-01; Fold-change: 1.66E-02; Z-score: 4.27E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C94     Bladder cancer Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.95E-04; Fold-change: -8.24E-01; Z-score: -2.52E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D02     Retinal cancer Click to Show/Hide
The Studied Tissue     Uvea
The Specified Disease     Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.30E-05; Fold-change: -7.69E-01; Z-score: -3.63E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D10     Thyroid cancer Click to Show/Hide
The Studied Tissue     Thyroid
The Specified Disease     Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.95E-02; Fold-change: -3.49E-02; Z-score: -1.23E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.52E-04; Fold-change: -1.99E-01; Z-score: -5.35E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D11     Adrenal cancer Click to Show/Hide
The Studied Tissue     Adrenal cortex
The Specified Disease     Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 5.99E-02; Fold-change: -1.40E-01; Z-score: -8.05E-01
DME expression in the diseased tissue of patients
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D12     Endocrine gland neoplasm Click to Show/Hide
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.21E-01; Fold-change: -8.86E-02; Z-score: -1.60E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.59E-01; Fold-change: -5.85E-02; Z-score: -8.65E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D42     Head and neck cancer Click to Show/Hide
The Studied Tissue     Head and neck tissue
The Specified Disease     Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.60E-43; Fold-change: -1.04E+00; Z-score: -2.77E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 03 Blood/blood-forming organ disease Click to Show/Hide
                  ICD-11: 3A51     Sickle cell disorder Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.33E-01; Fold-change: 2.07E-01; Z-score: 6.15E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3A70     Aplastic anaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.80E-01; Fold-change: -1.78E-01; Z-score: -8.02E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3B63     Thrombocytosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.38E-01; Fold-change: 2.02E-02; Z-score: 9.53E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3B64     Thrombocytopenia Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.53E-01; Fold-change: -2.81E-02; Z-score: -8.45E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 04 Immune system disease Click to Show/Hide
                  ICD-11: 4A00     Immunodeficiency Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.26E-01; Fold-change: -2.52E-02; Z-score: -1.20E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A40     Lupus erythematosus Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.26E-01; Fold-change: 8.56E-02; Z-score: 1.31E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A42     Systemic sclerosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.52E-01; Fold-change: -1.76E-01; Z-score: -4.80E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A43     Systemic autoimmune disease Click to Show/Hide
The Studied Tissue     Salivary gland tissue
The Specified Disease     Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.87E-03; Fold-change: 1.35E+00; Z-score: 1.15E+01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.03E-03; Fold-change: -4.90E-01; Z-score: -2.89E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A62     Behcet disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.37E-01; Fold-change: -7.93E-02; Z-score: -3.29E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4B04     Monocyte count disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.73E-01; Fold-change: 1.01E-01; Z-score: 2.96E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 05 Endocrine/nutritional/metabolic disease Click to Show/Hide
                  ICD-11: 5A11     Type 2 diabetes mellitus Click to Show/Hide
The Studied Tissue     Omental adipose tissue
The Specified Disease     Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.89E-01; Fold-change: -1.34E-01; Z-score: -5.05E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Liver tissue
The Specified Disease     Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.68E-01; Fold-change: -2.27E-01; Z-score: -6.62E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5A80     Ovarian dysfunction Click to Show/Hide
The Studied Tissue     Vastus lateralis muscle
The Specified Disease     Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.66E-02; Fold-change: -3.98E-02; Z-score: -2.36E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C51     Inborn carbohydrate metabolism disorder Click to Show/Hide
The Studied Tissue     Biceps muscle
The Specified Disease     Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.93E-01; Fold-change: -1.08E-01; Z-score: -6.18E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C56     Lysosomal disease Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.95E-01; Fold-change: -1.07E-01; Z-score: -5.29E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C80     Hyperlipoproteinaemia Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.56E-01; Fold-change: -1.10E-01; Z-score: -5.89E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.54E-01; Fold-change: -1.22E-01; Z-score: -3.83E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 06 Mental/behavioural/neurodevelopmental disorder Click to Show/Hide
                  ICD-11: 6A02     Autism spectrum disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.35E-01; Fold-change: -4.28E-02; Z-score: -1.49E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 6A20     Schizophrenia Click to Show/Hide
The Studied Tissue     Prefrontal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.98E-01; Fold-change: -1.76E-03; Z-score: -3.90E-03
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Superior temporal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.57E-01; Fold-change: -7.59E-02; Z-score: -5.90E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 6A60     Bipolar disorder Click to Show/Hide
The Studied Tissue     Prefrontal cortex
The Specified Disease     Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.49E-01; Fold-change: 1.01E-01; Z-score: 3.21E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 6A70     Depressive disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.07E-02; Fold-change: 5.82E-02; Z-score: 1.58E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Hippocampus
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.64E-01; Fold-change: -6.95E-02; Z-score: -2.21E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 08 Nervous system disease Click to Show/Hide
                  ICD-11: 8A00     Parkinsonism Click to Show/Hide
The Studied Tissue     Substantia nigra tissue
The Specified Disease     Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.26E-01; Fold-change: 7.00E-02; Z-score: 2.18E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A01     Choreiform disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.66E-01; Fold-change: 7.51E-02; Z-score: 2.73E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A20     Alzheimer disease Click to Show/Hide
The Studied Tissue     Entorhinal cortex
The Specified Disease     Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.74E-04; Fold-change: 1.62E-01; Z-score: 7.22E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A2Y     Neurocognitive impairment Click to Show/Hide
The Studied Tissue     White matter tissue
The Specified Disease     HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.63E-01; Fold-change: -8.23E-02; Z-score: -3.29E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A40     Multiple sclerosis Click to Show/Hide
The Studied Tissue     Plasmacytoid dendritic cells
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.68E-01; Fold-change: -5.96E-03; Z-score: -2.58E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Spinal cord
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.11E-01; Fold-change: 5.56E-02; Z-score: 1.59E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A60     Epilepsy Click to Show/Hide
The Studied Tissue     Peritumoral cortex tissue
The Specified Disease     Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 2.50E-01; Fold-change: 2.57E-01; Z-score: 1.06E+00
DME expression in the diseased tissue of patients
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.38E-01; Fold-change: -3.58E-02; Z-score: -1.25E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B01     Subarachnoid haemorrhage Click to Show/Hide
The Studied Tissue     Intracranial artery
The Specified Disease     Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.45E-04; Fold-change: -7.86E-01; Z-score: -1.43E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B11     Cerebral ischaemic stroke Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.75E-01; Fold-change: 1.83E-01; Z-score: 2.64E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Peripheral blood
The Specified Disease     Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.47E-01; Fold-change: 3.77E-02; Z-score: 2.16E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B60     Motor neuron disease Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.83E-01; Fold-change: 1.79E-01; Z-score: 1.03E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Cervical spinal cord
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.25E-01; Fold-change: -5.08E-01; Z-score: -7.85E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8C70     Muscular dystrophy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.50E-01; Fold-change: -2.51E-01; Z-score: -6.91E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8C75     Distal myopathy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.30E-01; Fold-change: -1.08E-01; Z-score: -4.60E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 09 Visual system disease Click to Show/Hide
                  ICD-11: 9A96     Anterior uveitis Click to Show/Hide
The Studied Tissue     Peripheral monocyte
The Specified Disease     Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.09E-02; Fold-change: -2.51E-01; Z-score: -8.80E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 11 Circulatory system disease Click to Show/Hide
                  ICD-11: BA41     Myocardial infarction Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.02E-01; Fold-change: 2.72E-01; Z-score: 3.85E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BA80     Coronary artery disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.35E-04; Fold-change: -3.17E-01; Z-score: -3.79E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BB70     Aortic valve stenosis Click to Show/Hide
The Studied Tissue     Calcified aortic valve
The Specified Disease     Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.51E-01; Fold-change: 2.30E-02; Z-score: 1.17E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 12 Respiratory system disease Click to Show/Hide
                  ICD-11: 7A40     Central sleep apnoea Click to Show/Hide
The Studied Tissue     Hyperplastic tonsil
The Specified Disease     Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.58E-01; Fold-change: -2.17E-01; Z-score: -3.69E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA08     Vasomotor or allergic rhinitis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.94E-02; Fold-change: 9.40E-01; Z-score: 2.63E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA0A     Chronic rhinosinusitis Click to Show/Hide
The Studied Tissue     Sinus mucosa tissue
The Specified Disease     Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.45E-01; Fold-change: 4.37E-02; Z-score: 1.08E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA22     Chronic obstructive pulmonary disease Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.42E-01; Fold-change: 3.98E-02; Z-score: 8.44E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Small airway epithelium
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.31E-01; Fold-change: 1.10E-01; Z-score: 2.20E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA23     Asthma Click to Show/Hide
The Studied Tissue     Nasal and bronchial airway
The Specified Disease     Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.34E-05; Fold-change: 6.69E-01; Z-score: 5.61E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CB03     Idiopathic interstitial pneumonitis Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.04E-01; Fold-change: -1.18E-01; Z-score: -3.76E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 13 Digestive system disease Click to Show/Hide
                  ICD-11: DA0C     Periodontal disease Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.97E-04; Fold-change: -1.92E-01; Z-score: -5.37E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DA42     Gastritis Click to Show/Hide
The Studied Tissue     Gastric antrum tissue
The Specified Disease     Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.34E-01; Fold-change: -4.80E-01; Z-score: -8.85E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DB92     Non-alcoholic fatty liver disease Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.76E-02; Fold-change: -2.86E-01; Z-score: -7.30E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DB99     Hepatic failure Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.88E-03; Fold-change: -9.78E-01; Z-score: -3.07E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DD71     Ulcerative colitis Click to Show/Hide
The Studied Tissue     Colon mucosal tissue
The Specified Disease     Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 3.65E-04; Fold-change: -6.35E-01; Z-score: -1.33E+00
DME expression in the diseased tissue of patients
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DD91     Irritable bowel syndrome Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.19E-01; Fold-change: -1.46E-01; Z-score: -3.26E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 14 Skin disease Click to Show/Hide
                  ICD-11: EA80     Atopic eczema Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.89E-04; Fold-change: 2.21E-01; Z-score: 1.71E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: EA90     Psoriasis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.61E-07; Fold-change: -2.49E-01; Z-score: -5.58E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 3.02E-02; Fold-change: 2.31E-01; Z-score: 4.40E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: ED63     Acquired hypomelanotic disorder Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.40E-01; Fold-change: 3.42E-01; Z-score: 1.17E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: ED70     Alopecia or hair loss Click to Show/Hide
The Studied Tissue     Skin from scalp
The Specified Disease     Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.64E-03; Fold-change: 1.93E-01; Z-score: 4.24E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: EK0Z     Contact dermatitis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.51E-02; Fold-change: 3.58E-01; Z-score: 1.42E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 15 Musculoskeletal system/connective tissue disease Click to Show/Hide
                  ICD-11: FA00     Osteoarthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.40E-01; Fold-change: 7.01E-02; Z-score: 2.91E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Synovial tissue
The Specified Disease     Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.28E-01; Fold-change: -8.02E-01; Z-score: -6.75E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA20     Rheumatoid arthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.04E-01; Fold-change: -8.00E-02; Z-score: -1.27E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Synovial tissue
The Specified Disease     Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.45E-06; Fold-change: -1.71E+00; Z-score: -4.86E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA24     Juvenile idiopathic arthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.44E-01; Fold-change: 3.15E-02; Z-score: 5.40E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA92     Inflammatory spondyloarthritis Click to Show/Hide
The Studied Tissue     Pheripheral blood
The Specified Disease     Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.89E-01; Fold-change: -2.14E-01; Z-score: -9.51E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FB83     Low bone mass disorder Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.40E-01; Fold-change: 2.55E-02; Z-score: 1.49E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 16 Genitourinary system disease Click to Show/Hide
                  ICD-11: GA10     Endometriosis Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.04E-01; Fold-change: 3.25E-01; Z-score: 6.37E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: GC00     Cystitis Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.69E-04; Fold-change: -1.07E+00; Z-score: -2.80E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 19 Condition originating in perinatal period Click to Show/Hide
                  ICD-11: KA21     Short gestation disorder Click to Show/Hide
The Studied Tissue     Myometrium
The Specified Disease     Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.75E-01; Fold-change: -5.16E-02; Z-score: -1.22E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 20 Developmental anomaly Click to Show/Hide
                  ICD-11: LD2C     Overgrowth syndrome Click to Show/Hide
The Studied Tissue     Adipose tissue
The Specified Disease     Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.06E-01; Fold-change: 1.39E-01; Z-score: 2.95E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: LD2D     Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide
The Studied Tissue     Perituberal tissue
The Specified Disease     Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.06E-02; Fold-change: 2.63E-01; Z-score: 1.57E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
References
1 Mass balance, pharmacokinetics and metabolism of the selective S1P1 receptor modulator ponesimod in humans
2 DrugBank(Pharmacology-Metabolism):Ponesimod
3 CYP4F enzymes are responsible for the elimination of fingolimod (FTY720), a novel treatment of relapsing multiple sclerosis. Drug Metab Dispos. 2011 Feb;39(2):191-8.
4 cDNA cloning and expression of a novel cytochrome p450 (cyp4f12) from human small intestine. Biochem Biophys Res Commun. 2001 Feb 2;280(4):1135-41.
5 Pharmacokinetics, Disposition, and Biotransformation of [(14)C]Omecamtiv Mecarbil in Healthy Male Subjects after a Single Intravenous or Oral Dose
6 Absorption, disposition and metabolic pathway of amiselimod (MT-1303) in healthy volunteers in a mass balance study

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.