Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1090) | |||||
---|---|---|---|---|---|
DME Name | Aminoglycoside phosphotransferase (aph-Ib), Campylobacter jejuni | ||||
Synonyms | Campylobacter jejuni aminoglycoside phosphotransferase; 2''-aminoglycoside phosphotransferase; Aph(2'')-Ib | ||||
Gene Name | aph(2'')-Ib | ||||
UniProt ID | |||||
EC Number | EC: 2.7.1.190 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Campylobacter jejuni (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MIDLDVEIYQHLNEQIKINKLCYLSSGDDSDTFLCNEQYVVKVPKRDSVRFAQKREFELY
RFLENCNLSYQTPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKEL HSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENISSNAV IFNYIPCLVHNDFSANNLIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGR KVLKYYQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKGVSELLQTQAEMFIF |
||||
Function | This enzyme is the most clinically important aminoglycoside-modifying enzyme in Gram-positive bacteria, responsible for high-level resistance in both Enterococci and Staphylococci. And this bacterial enzyme phosphorylates many 4,6-disubstituted aminoglycoside antibiotics that have a hydroxyl group at position 2'', including kanamycin A, kanamycin B, tobramycin, dibekacin, arbekacin, amikacin, gentamicin C, sisomicin and netilmicin. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 4 Drugs | ||||
Sisomicin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
Gentamicin |
Drug Info | Approved | Acute upper respiratory infection | ICD11: CA07 | [2] |
Kanamycin |
Drug Info | Approved | Pulmonary tuberculosis | ICD11: 1B10 | [2] |
Tobramycin |
Drug Info | Approved | Conjunctivitis | ICD11: 9A60 | [2] |
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Dibekacin |
Drug Info | Phase 4 | Acute lower respiratory infection | ICD11: CA4Z | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.