Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1095) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Bacteroides fragilis | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Metallo-beta-lactamase type 2a; Carbapenem and cephamycin resistance; CCRA; Imipenem-cefoxitin hydrolyzing enzyme; Metallo-beta-lactamase type IIa; Zinc-requiring beta-lactamase; ccrA; cfiA | ||||
Gene Name | ccrA | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacteroides fragilis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKTVFILISMLFPVAVMAQKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVI
NNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYA NQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGG CMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVN QYIESTSKP |
||||
Structure | |||||
Function | This enzyme confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 5 Drugs | ||||
Amoxicillin |
Drug Info | Approved | Acute otitis media | ICD11: AB00 | [1] |
Penicillin G |
Drug Info | Approved | Diphtheria | ICD11: 1C17 | [2] |
Cephalothin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [3] |
Meropenem |
Drug Info | Approved | Pseudomonas infection | ICD11: 1G40 | [1] |
Cefazolin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1], [3] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.