| General Information of DME (ID: DME1097) |
| DME Name |
N-ethylmaleimide reductase (nemA), Escherichia coli
|
| Synonyms |
N-ethylmaleimide reducing enzyme; NEM reductase; JW1642; b1650; nemA; ydhN
|
| Gene Name |
nemA
|
| UniProt ID |
|
| Gene ID |
|
| EC Number |
EC: 1.3.1.- (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.-
|
| Lineage |
Species: Escherichia coli (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
|
|
Interactome(loading-time for this interactome depdends on the speed of web connection)
|
Interactions between Xenobiotics and DME (XEOTIC)  Jump to Detailed Interactome Data  |
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data |
|
|
|
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
|
| Tissue Distribution |
Primarily distributed in human gut.
|
| Sequence |
MSSEKLYSPLKVGAITAANRIFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLIISEAT
QISAQAKGYAGAPGIHSPEQIAAWKKITAGVHAENGHMAVQLWHTGRISHASLQPGGQAP
VAPSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPGIVNDFRQAIANAREAGFDLVE
LHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGT
FQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEPDWAGGEPYTDAFREKVRARFHGPIIG
AGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRKAELNPQRAESFYGGGAEGYT
DYPTL
|
| Pathway |
Microbial metabolism in diverse environments (ecj01120 ) |
| Nitrotoluene degradation (ecj00633 ) |
| Function |
This enzyme is involved in the degradation of toxic compounds. And it can use a variety of substrates, including the nitrate ester explosives glycerol trinitrate (GTN) and pentaerythritol tetranitrate (PETN), chromate and various electrophiles such as quinones. Moreover, it also can catalyze the reduction of N-ethylmaleimide (NEM) to N-ethylsuccinimide. Together with NfsA and NfsB, can use the nitroaromatic explosive 2,4,6-trinitrotoluene (TNT).
|
|
|
|
|
|
|
