Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1149) | |||||
---|---|---|---|---|---|
DME Name | CDP-alcohol phosphatidyltransferase (pgsA), Streptococcus mitis | ||||
Synonyms | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; pgsA; AXK38_10040; CYK18_09100; D8842_08295; FBF73_01305; SK1126_1848; SK642_1900 | ||||
Gene Name | pgsA | ||||
UniProt ID | |||||
EC Number | EC: 2.7.8.5 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Streptococcus mitis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human oral cavity. | ||||
Sequence |
MKKEQIPNLLTIGRILFIPIFIFILTVGNSIESHIVAAIIFAIASITDYLDGYLARKWNV
VSNFGKFADPMADKLLVMSAFIMLIELGMAPAWIVAVIICRELAVTGLRLLLVETGGTVL AAAMPGKIKTFSQMFAIIFLLLHWTLIGQVLLYVALFFTIYSGYDYFKGSAYVFKGTFGS K |
||||
Function | This enzyme catalyzes the committed step in the biosynthesis of acidic phospholipids known by the common names phophatidylglycerols and cardiolipins. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Daptomycin |
Drug Info | Approved | Methicillin-resistant staphylococcus infection | ICD11: 1D01 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Mutations in cdsA and pgsA correlate with daptomycin resistance in Streptococcus mitis and S. oralis. Antimicrob Agents Chemother. 2019 Jan 29;63(2). pii: e01531-18. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.