Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1154) | |||||
---|---|---|---|---|---|
DME Name | ATP-dependent 6-phosphofructokinase (pfkA), Lactobacillus delbrueckii | ||||
Synonyms | Phosphofructokinase; Phosphohexokinase; Phosphohexokinase pfkA; pfkA; ATP-PFK | ||||
Gene Name | pfkA | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 2.7.1.11 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus delbrueckii (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKRIGILTSGGDAPGMNAAVRAVTRVAIANGLEVFGIRYGFAGLVAGDIFPLESEDVAHL
INVSGTFLYSARYPEFAEEEGQLAGIEQLKKHGIDAVVVIGGDGSYHGALQLTRHGFNSI GLPGTIDNDIPYTDATIGYDTACMTAMDAIDKIRDTASSHHRVFIVNVMGRNCGDIAMRV GVACGADAIVIPERPYDVEEIANRLKQAQESGKDHGLVVVAEGVMTADQFMAELKKYGDF DVRANVLGHMQRGGTPTVSDRVLASKLGSEAVHLLLEGKGGLAVGIENGKVTSHDILDLF DESHRGDYDLLKLNADLSR |
||||
Structure | |||||
Function | This enzyme catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Fructose 6-phosphate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.