Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1235)
DME Name Cytochrome P450 51B1 (cyp51), Mycobacterium tuberculosis
Synonyms Cytochrome P450 family 51 subfamily B member 1; Cytochrome cyp51B1; MMAR_4932; P450 51B1; cyp51B1
Gene Name cyp51B1
UniProt ID
B2HH81_MYCMM
EC Number    EC: 1.14.14.154     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.154
Lineage    Species: Mycobacterium tuberculosis     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Actinobacteria
Class: Actinobacteria
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycobacterium
Species: Mycobacterium tuberculosis
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MTTAIVPRVSGGEEEHGHLEEFRTDPIGLMQRVRDECGDVGWFQLANKHVVLLSGAKANE
FFFRSSDEELDQAEAYPFMTPIFGKGVVFDASPERRKEMLHNSALRGEHMKGHATTIERE
VHRMIENWGQEGEIDLLEFFAELTIYTSTSCLIGTKFRNQLDSRFAHFYHELERGTDPLC
YVDPYLPIESFRRRDEARKGLVALVQDIMHQRVANPPTDKRDRDMLDVLVSITDEQGNPR
FCADEVTGMFISLMFAGHHTSSGTSAWTLIELLRHPDAYAAVIDELDELYADGQPVSFHA
LRQIPRLENVLKETLRLHPPLIILMRVAKGEFQVEGYPIHEGELVAASPAISNRIAEDFP
DPDEFVPERYQEPRQEDLINRWTWIPFGAGRHRCVGAAFATMQIKAIFSVLLREYEFEMA
QPADSYRNDHSKMVVQLARPARVRYRRRKMSDNRGH
Pathway Biosynthesis of secondary metabolites (mmi01110 )
Metabolic pathways (mmi01100 )
Steroid biosynthesis (mmi00100 )
Function This enzyme is cytochrome P-450 (heme-thiolate) protein acting on a range of steroids with a 14alpha-methyl group, such as obtusifoliol and lanosterol. And it catalyses a hydroxylation and a reduction of the 14alpha-methyl group, followed by a second hydroxylation, resulting in the elimination of formate and formation of a 14(15) double bond.
Full List of Drug(s) Metabolized by This DME
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          2 Drugs
Dihydrolanosterol
 Drug Info Investigative Discovery agent ICD: N.A. [1]
Lanosterol
 Drug Info Investigative Alzheimer disease ICD11: 8A20 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR013789 Berberine Thalfendine Oxidation - Demethylation Berberine [2], [3], [4]
MR013787 Berberine Berberrubine Oxidation - Demethylation Berberine [2], [3], [4]
MR004172 Dihydrolanosterol 32-hydroxy-24,25-dihydrolanosterol (lanost-8-ene-3 beta,32-diol) Unclear - Unclear Dihydrolanosterol [5]
MR004174 Dihydrolanosterol 4,4-dimethyl-5 alpha-cholesta-8,14-dien-3 beta-ol Unclear - Unclear Dihydrolanosterol [5], [6]
MR005364 Lanosterol 4-4-dimethylcholestatrienol Oxidation - Dealkylation Lanosterol [1]
References
1 Function, essentiality, and expression of cytochrome P450 enzymes and their cognate redox partners in Mycobacterium tuberculosis: are they drug targets? Appl Microbiol Biotechnol. 2019 May;103(9):3597-3614.
2 The metabolism of berberine and its contribution to the pharmacological effects
3 CYP2D plays a major role in berberine metabolism in liver of mice and humans
4 Transformation of berberine to its demethylated metabolites by the CYP51 enzyme in the gut microbiota
5 Purification and characterization of rat sterol 14-demethylase P450 (CYP51) expressed in Escherichia coli
6 Metabolism of 32-hydroxy-24,25-dihydrolanosterol by purified cytochrome P-45014DM from yeast. Evidence for contribution of the cytochrome to whole process of lanosterol 14 alpha-demethylation

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.