Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1662) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 121A1 (cyp121), Mycobacterium tuberculosis | ||||
Synonyms | Cytochrome P450 family 121 subfamily A member 1; Cytochrome P450 121; Cytochrome P450 MT2; MTCY339.34c; Mycocyclosin synthase; Rv2276; cyp121 | ||||
Gene Name | cyp121 | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.14.19.70 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Mycobacterium tuberculosis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MTATVLLEVPFSARGDRIPDAVAELRTREPIRKVRTITGAEAWLVSSYALCTQVLEDRRF
SMKETAAAGAPRLNALTVPPEVVNNMGNIADAGLRKAVMKAITPKAPGLEQFLRDTANSL LDNLITEGAPADLRNDFADPLATALHCKVLGIPQEDGPKLFRSLSIAFMSSADPIPAAKI NWDRDIEYMAGILENPNITTGLMGELSRLRKDPAYSHVSDELFATIGVTFFGAGVISTGS FLTTALISLIQRPQLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVR KGELVLVLLEGANFDPEHFPNPGSIELDRPNPTSHLAFGRGQHFCPGSALGRRHAQIGIE ALLKKMPGVDLAVPIDQLVWRTRFQRRIPERLPVLW |
||||
Structure | |||||
Function | This enzyme is a P-450 heme-thiolate protein, and it catalyzes C-C bond formation between the carbons ortho to the phenolic hydroxyl of cyclo(L-tyr-L-tyr) (cYY) producing mycocyclosin. The enzme also can use cyclo(L-Tyr-L-Phe) (cYF), cyclo(L-Tyr-L-Trp) (cYW) and cyclo(L-Tyr-L-3,4-dihydroxyphenylalanine) (cY-DOPA) as substrate. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Phytanic acid |
Drug Info | Investigative | Adrenomyeloneuropathy | ICD11: 5C57 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.