Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN001)
DME Name Adenylate kinase isoenzyme 1 (AK1), Homo sapiens
Gene Name AK1
UniProt ID
KAD1_HUMAN
EC Number    EC: 3.6.1.5     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Acid anhydride hydrolase
Acid anhydride hydrolase
EC: 3.6.1.5
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD
SVFSQVCTHLDALK
Structure
1Z83 ; 2C95 ; 7DE3 ; 7X7S ;
Function Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Exhibits nucleoside diphosphate kinase activity, catalyzing the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP and dTTP from the corresponding diphosphate substrates with either ATP or GTP as phosphate donor. Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Adenosine
 Drug Info Approved Atrial fibrillation ICD11: BC81 [1]
Adefovir dipivoxil
 Drug Info Approved Viral hepatitis ICD11: 1E51 [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000062 Adefovir Adefovir monophosphate Other reaction - Phosphorylation Adefovir dipivoxil [2]
MR000072 ADP AMP Other reaction - Dephosphorylation Adenosine [1], [3]
MR000070 AMP ADP Other reaction - Phosphorylation Adenosine [1], [3]
References
1 Adenosine Metabolism: Emerging Concepts for Cancer Therapy Cancer Cell. 2019 Dec 9;36(6):582-596. doi: 10.1016/j.ccell.2019.10.007.
2 Effective metabolism and long intracellular half life of the anti-hepatitis B agent adefovir in hepatic cells Biochem Pharmacol. 2004 Nov 1;68(9):1825-31. doi: 10.1016/j.bcp.2004.07.010.
3 Purine signaling pathway dysfunction in autism spectrum disorders: Evidence from multiple omics data. Front Mol Neurosci. 2023 Feb 3;16:1089871. doi: 10.3389/fnmol.2023.1089871.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.