Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN750)
DME Name UbiA prenyltransferase domain-containing protein 1 (UBIAD1), Homo sapiens
Gene Name UBIAD1
UniProt ID
UBIA1_HUMAN
EC Number    EC: 2.5.1.-     (Click to Show/Hide the Complete EC Tree)
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.-
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSA
SLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRT
LVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSPLKLEHLALIYFGGLSGSFLYTGGIGF
KYVALGDLIILITFGPLAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESD
REAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQF
RSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI
Function Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10 . MK-4 is a vitamin K2 isoform present at high concentrations in the brain, kidney and pancreas, and is required for endothelial cell development . Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4 . Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosynthetic enzyme: coenzyme Q10, also named ubiquinone, plays an important antioxidant role in the cardiovascular system . Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from NOS3/eNOS-dependent oxidative stress .
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Phytonadione
 Drug Info Approved Vitamin K deficiency ICD11: 5B55-5B5F [1]
Phytonadione
 Drug Info Approved Vitamin K deficiency ICD11: 5B55-5B5F [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR008147 Hydroquinone Menatetrenone Unclear - Unclear Phytonadione [1]
References
1 Recent trends in the metabolism and cell biology of vitamin K with special reference to vitamin K cycling and MK-4 biosynthesis
2 Vitamin K nutrition, metabolism, and requirements: current concepts and future research

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.