Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1063)
DME Name Nitroreductase (NTR), Salmonella enterica
Synonyms FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; AAK29_19565; AAP89_17340; ABO94_21460; AF480_20870; AF488_23150; AF489_23340; AIC76_20195; AU613_12225; AXR84_20760; AXU58_04975; C2253_16765; CD48_22070; CE87_20375; CET98_22760; CQG18_18555; CVR97_26810; D4369_19420; D4380_20855; D4401_19160; D4E62_20230; D6360_18430; D7F20_19765; D7H43_20545; DJ388_15780; DKJ11_20120; DKU57_16540; DLM31_17395; DNV30_18555; DO698_18905; DOJ90_20570; DOQ88_18330; DPJ93_20300; DQ848_17880; DRM14_15155; DSF69_18065; DSR36_20995; DUW48_14845; EBO41_17185; EBP31_19365; EGU67_18695; EHB24_16995; EHC98_18885; EIW53_20245; GW08_19510; LZ63_23085; NG18_18155; NU83_21515; QA89_14925; QB40_21055; QD15_17380; RJ78_20865; SAMEA4398682_04794; SBOV39431; Y934_22205; YG50_14570; YI33_18440; YR17_18395; ZA53_16690; ZB89_19155
Gene Name yieF
UniProt ID
A0A5K1UB29_SALTM
EC Number    EC: 1.5.1.39     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-NH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.5.1.39
Lineage    Species: Salmonella enterica     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica
Subspecies: Salmonella enterica subsp. enterica serovar Typhimurium
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MKKGARMSETLNVVTLLGSLRKGSFNGMVARTLPKVAPAGMTVSPLPSIGDIPLYDADIQ
QEEGFPASVEALAEQIRNADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQPLAGKPVLIQ
TSSMGAIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVVDQGTLDHLTG
QLTAFGEFIQRVKA
Function This enzyme can reduce other azo dyes, such as Methyl Red, Rocceline, Solar Orange and Sumifix Black B.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Menadione
 Drug Info Approved Vitamin deficiency ICD11: 5B55 [1], [2]
References
1 Purification and characterization of wild-type and mutant "classical" nitroreductases of Salmonella typhimurium. L33R mutation greatly diminishes binding of FMN to the nitroreductase of S. typhimurium. J Biol Chem. 1998 Sep 11;273(37):23922-8.
2 Identification and functional characterization of arylamine N-acetyltransferases in eubacteria: evidence for highly selective acetylation of 5-aminosalicylic acid. J Bacteriol. 2001 Jun;183(11):3417-27.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.