Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1133) | |||||
---|---|---|---|---|---|
DME Name | Cellobiose 2-epimerase (CE), Eubacterium cellulosolvens | ||||
Synonyms | Cellobiose epimerase; CS-HRCE; Caob-CE; B15CE; BfCE; CE; CE-NE1; CsCE; ce13 | ||||
Gene Name | ce13 | ||||
UniProt ID | |||||
EC Number | EC: 5.1.3.11 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Eubacterium cellulosolvens (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKNEVVYKQLTEKILPFWNAMRDDENGGFYGYMSEDLHIDDHADKGCILNSRILWFYSTA
YMYLQDEKLLDNAKHAFEFLKTYCFDPMCGGIFWSVRYNGKPADTTKHTYNQAFAIYALS AYYEATGSIEAIAIAEIIYEKIEDTMRDTKGYLEAFTRDFRPADNDKLSENGVMAERTMN TLLHIIEAYSALVHALRKKVADPAKGDVRDELFMNVVENKLAAALELMRDKFYNSDRHRL DVFFDKEYESLIDLTSYGHDIEASWLLEWAAGILDDEEITESLHPISSDLVEKVYKEAFD GHSIVNECEDGDVNTDRIWWVEAESVLGFLKAFEREGKEEYRKAAHEILAFILDKQVDKR EGSEWFEMLKEDGTPCHKPMVREWKCPYHNGRMCLEILKSGIEIG |
||||
Function | This enzyme catalyzes the interconversion between D-glucose and D-mannose residues at the reducing end of beta-1,4-linked disaccharides by epimerizing the hydroxyl group at the C-2 position of the glucose moiety. Besides, it catalyzes the reversible epimerization of cellobiose to 4-O-beta-D-glucopyranosyl-D-mannose (Glc-Man) and epimerizes lactose to epilactose. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
M-7403 |
Drug Info | Phase 1/2 | Prostate cancer | ICD11: 2C82 | [1] |
Lactose |
Drug Info | Phase 1 | Lactose intolerance | ICD11: 5C61 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Cloning and sequencing of the gene for cellobiose 2-epimerase from a ruminal strain of Eubacterium cellulosolvens. FEMS Microbiol Lett. 2008 Oct;287(1):34-40. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.