Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1234) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 124 (cyp124), Mycobacterium tuberculosis | ||||
Synonyms | Cytochrome P450 family 124 subfamily A member 1; Cholest-4-en-3-one C26-monooxygenase; Cholest-4-en-3-one C26-monooxygenase [(25R)-3-oxocholest-4-en-26-oate forming]; Cholesterol C26-monooxygenase; Cholesterol C26-monooxygenase [(25R)-3beta-hydroxycholest-5-en-26-oate forming]; MTCY339.44c; Methyl-branched lipid omega-hydroxylase; Rv2266; Steroid C26-monooxygenase; Steroid C27-monooxygenase; cyp124 | ||||
Gene Name | cyp124 | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.14.15.14 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Mycobacterium tuberculosis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MGLNTAIATRVNGTPPPEVPIADIELGSLDFWALDDDVRDGAFATLRREAPISFWPTIEL
PGFVAGNGHWALTKYDDVFYASRHPDIFSSYPNITINDQTPELAEYFGSMIVLDDPRHQR LRSIVSRAFTPKVVARIEAAVRDRAHRLVSSMIANNPDRQADLVSELAGPLPLQIICDMM GIPKADHQRIFHWTNVILGFGDPDLATDFDEFMQVSADIGAYATALAEDRRVNHHDDLTS SLVEAEVDGERLSSREIASFFILLVVAGNETTRNAITHGVLALSRYPEQRDRWWSDFDGL APTAVEEIVRWASPVVYMRRTLTQDIELRGTKMAAGDKVSLWYCSANRDESKFADPWTFD LARNPNPHLGFGGGGAHFCLGANLARREIRVAFDELRRQMPDVVATEEPARLLSQFIHGI KTLPVTWS |
||||
Structure | |||||
Function | This enzyme is a P-450 heme-thiolate protein, and it primarily hydroxylates the omega-carbon of a number of methyl-branched lipids, including (2E,6E)-farnesol, phytanate, geranylgeraniol, 15-methylpalmitate and (2E,6E)-farnesyl diphosphate. And it also catalyzes the sequential oxidation of the terminal methyl of cholest-4-en-3-one into (25R)-26-hydroxycholest-4-en-3-one (alcohol), (25R)-26-oxocholest-4-en-3-one (aldehyde), to finally yield the carboxylic acid (25R)-3-oxocholest-4-en-26-oate. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Vitamin D |
Drug Info | Approved | Hyperparathyroidism | ICD11: 5A51 | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Provitamin D3 |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | Identification of Mycobacterium tuberculosis enzyme involved in vitamin D and 7-dehydrocholesterol metabolism. J Steroid Biochem Mol Biol. 2017 May;169:202-209. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.