Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1525) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 101D2 (cyp101), Novosphingobium aromaticivorans | ||||
Synonyms | Cytochrome P450 family 101 subfamily D member 2; Cytochrome P450-cam D2, Cytochrome P450cam D2; P450 101D2; cyp101D2 | ||||
Gene Name | cyp101 | ||||
UniProt ID | |||||
EC Number | EC: 1.14.15.1 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Novosphingobium aromaticivorans (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MATNFDEAVRAKVERPANVPEDRVYEIDMYALNGIEDGYHEAWKKVQHPGIPDLIWTPFT
GGHWIATNGDTVKEVYSDPTRFSSEVIFLPKEAGEKYQMVPTKMDPPEHTPYRKALDKGL NLAKIRKVEDKVREVASSLIDSFAARGECDFAAEYAELFPVHVFMALADLPLEDIPVLSE YARQMTRPEGNTPEEMATDLEAGNNGFYAYVDPIIRARVGGDGDDLITLMVNSEINGERI AHDKAQGLISLLLLGGLDTVVNFLSFFMIHLARHPELVAELRSDPLKLMRGAEEMFRRFP VVSEARMVAKDQEYKGVFLKRGDMILLPTALHGLDDAANPEPWKLDFSRRSISHSTFGGG PHRCAGMHLARMEVIVTLEEWLKRIPEFSFKEGETPIYHSGIVAAVENVPLVWPIAR |
||||
Structure | |||||
Function | This enzyme is a P-450 heme-thiolate protein, and it also acts on (-)-camphor and 1,2-campholide, forming 5-exo-hydroxy-1,2-campholide. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 3 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
BRN-1907611 |
Drug Info | Phase 3 | Inflammatory bowel disease | ICD11: DD72 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | A cytochrome P450 class I electron transfer system from Novosphingobium aromaticivorans. Appl Microbiol Biotechnol. 2010 Mar;86(1):163-75. | ||||
2 | DrugBank(Pharmacology-Metabolism)BRN-1907611 |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.