Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN024)
DME Name Nucleoside diphosphate kinase B (NME2), Homo sapiens
Gene Name NME2
UniProt ID
NDKB_HUMAN
EC Number    EC: 1.1.1.105     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.105
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Structure
1NSK ; 1NUE ; 3BBB ; 3BBC ; 3BBF ; 7KPF ;
Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not. Exhibits histidine protein kinase activity.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Adefovir dipivoxil
 Drug Info Approved Viral hepatitis ICD11: 1E51 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000063 Adefovir monophosphate Adefovir Diphosphate Other reaction - Phosphorylation Adefovir dipivoxil [2]
References
1 Liquid oral suspension adefovir dipivoxil (GS-02-526): an update on treatments for hepatitis B infection. Expert Rev Anti Infect Ther. 2014 Aug;12(8):919-28. doi: 10.1586/14787210.2014.928588.
2 Effective metabolism and long intracellular half life of the anti-hepatitis B agent adefovir in hepatic cells Biochem Pharmacol. 2004 Nov 1;68(9):1825-31. doi: 10.1016/j.bcp.2004.07.010.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.