Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1063) | |||||
|---|---|---|---|---|---|
| DME Name | Nitroreductase (NTR), Salmonella enterica | ||||
| Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; AAK29_19565; AAP89_17340; ABO94_21460; AF480_20870; AF488_23150; AF489_23340; AIC76_20195; AU613_12225; AXR84_20760; AXU58_04975; C2253_16765; CD48_22070; CE87_20375; CET98_22760; CQG18_18555; CVR97_26810; D4369_19420; D4380_20855; D4401_19160; D4E62_20230; D6360_18430; D7F20_19765; D7H43_20545; DJ388_15780; DKJ11_20120; DKU57_16540; DLM31_17395; DNV30_18555; DO698_18905; DOJ90_20570; DOQ88_18330; DPJ93_20300; DQ848_17880; DRM14_15155; DSF69_18065; DSR36_20995; DUW48_14845; EBO41_17185; EBP31_19365; EGU67_18695; EHB24_16995; EHC98_18885; EIW53_20245; GW08_19510; LZ63_23085; NG18_18155; NU83_21515; QA89_14925; QB40_21055; QD15_17380; RJ78_20865; SAMEA4398682_04794; SBOV39431; Y934_22205; YG50_14570; YI33_18440; YR17_18395; ZA53_16690; ZB89_19155 | ||||
| Gene Name | yieF | ||||
| UniProt ID | |||||
| EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Salmonella enterica (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKKGARMSETLNVVTLLGSLRKGSFNGMVARTLPKVAPAGMTVSPLPSIGDIPLYDADIQ
QEEGFPASVEALAEQIRNADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQPLAGKPVLIQ TSSMGAIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVVDQGTLDHLTG QLTAFGEFIQRVKA |
||||
| Function | This enzyme can reduce other azo dyes, such as Methyl Red, Rocceline, Solar Orange and Sumifix Black B. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Menadione |
Drug Info | Approved | Vitamin deficiency | ICD11: 5B55 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

