| General Information of DME (ID: DME1069) |
| DME Name |
Nicotinate dehydrogenase (nicA), Pseudomonas putida
|
| Synonyms |
Nicotinate degradation protein A; Nicotinate dehydrogenase small subunit; PP_3947; ndhS; nicA
|
| Gene Name |
nicA
|
| UniProt ID |
|
| Gene ID |
|
| EC Number |
EC: 1.17.2.1 (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH/CH2 oxidoreductase
MCD acceptor oxidoreductase
EC: 1.17.2.1
|
| Lineage |
Species: Pseudomonas putida (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas putida
Subspecies: Pseudomonas putida S16
|
|
Interactome(loading-time for this interactome depdends on the speed of web connection)
|
Interactions between Xenobiotics and DME (XEOTIC)  Jump to Detailed Interactome Data  |
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data |
|
|
|
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
|
| Tissue Distribution |
Primarily distributed in human gut.
|
| Sequence |
MQTTISLQVNGQPVEVSAMPDTPLLLILRNDLCLNGPKYGCGLGECGACTVIIDGVAARS
CVIPLAGAAGRNITTLEGLGSKAAPHPVQQAFIDEQAAQCGYCMNGMIMTAKALLDRIPE
PSDEQIRNELSANLCRCGTHVEILRAVRRAAETRRKP
|
| Pathway |
Metabolic pathways (ppu01100 ) |
| Microbial metabolism in diverse environments (ppu01120 ) |
| Nicotinate and nicotinamide metabolism (ppu00760 ) |
| Function |
This enzyme is subunit of the two-component enzyme NicAB that mediates nicotinate hydroxylation, the first step in the aerobic nicotinate degradation pathway. And it mediates conversion of nicotinate into 6-hydroxynicotinate (6HNA).
|
|
|
|
|
|
|
