Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1317)
DME Name Alcohol dehydrogenase (ADH), Lactobacillus reuteri
Synonyms Alcohol dehydrogenase AdhP; Zinc-dependent alcohol dehydrogenase; Zn-dependent alcohol dehydrogenase; Iron-containing alcohol dehydrogenase; B5F04_01565; B5G22_01675; DKZ26_04195; DKZ35_01550; EGO58_03565; EW144_06055; LRLP16767_LR202_00415; lr1793
Gene Name ADH
UniProt ID
A4L2V0_LACRE
Gene ID
5188789
EC Number    EC: 1.1.1.1     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.1
Lineage    Species: Lactobacillus reuteri     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Lactobacillaceae
Genus: Lactobacillus
Species: Lactobacillus reuteri
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MNRQFDFLMPSVNFFGPGVIAKIGDRAKMLNMHKPLIVTTEGLSKIDNGPVKQTVASLEK
AGVDYAVFTGAEPNPKIRNVQAGKKMYQDENCDSIITVGGGSAHDCGKGIGIVLTNGDDI
SKLAGIETLKNPLPPLMAVNTTAGTGSELTRHAVITNEKTHLKFVVVSWRNIPLVSFNDP
MLMLDIPKDITAATGCDAFVQAIEPYVSVDHNPITDSQCKEAIQLIQTALPEVVANGHNI
EARTKMVEAEMLAGMAFNNANLGYVHAMAHQLGGQYDAPHGVCCALLLTTVEEYNLIACP
ERFAELAKVMGFDTTGLTLYEAAQKSIDGMREMCRLVGIPSSIKEIGAKPEDFEMMAKNA
LKDGNAFSNPRKGTVEDIVKLYQKAYDGIY
Function This enzyme uses NAD+ to oxidize ethanol and 1,3-propanediol.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Abacavir
 Drug Info Approved Human immunodeficiency virus infection ICD11: 1C60 [1]
Permethrin
 Drug Info Approved Scabies ICD11: 1G04 [2]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          1 Drugs
D-glucose
 Drug Info Investigative Discovery agent ICD: N.A. [3], [4]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000004 Abacavir 2269W93(Carboxylate) Oxidation - Oxidation Abacavir [1]
MR009996 Methadone Methadol Unclear - Unclear Methadone [5], [6]
MR002002 Phenoxybenzyl alcohol 2-Phenoxybenzaldehyde Oxidation - Dehydrogenation Permethrin [7]
MR009521 Regorafenib M3 Regorafenib M4 Oxidation - N-demethylation Regorafenib [8]
MR006366 SC-47945 DOPET Unclear - Unclear SC-47945 [9]
MR006778 4-Hydroxy tolbutamide 4-Carboxytolbutamide Unclear - Unclear Tolbutamide [10]
⏷ Show the Full List of 6 MR(s)
References
1 The metabolic activation of abacavir by human liver cytosol and expressed human alcohol dehydrogenase isozymes Chem Biol Interact. 2002 Nov 10;142(1-2):135-54. doi: 10.1016/s0009-2797(02)00059-5.
2 Human metabolic interactions of environmental chemicals J Biochem Mol Toxicol. 2007;21(4):182-6. doi: 10.1002/jbt.20175.
3 1,3-Propanediol:NAD+ oxidoreductases of Lactobacillus brevis and Lactobacillus buchneri. Appl Environ Microbiol. 1992 Jun;58(6):2005-10.
4 Aciduric strains of Lactobacillus reuteri and Lactobacillus rhamnosus, isolated from human feces, have strong adhesion and aggregation properties. Probiotics Antimicrob Proteins. 2018 Mar;10(1):89-97.
5 Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
6 Effects of cytochrome P450 single nucleotide polymorphisms on methadone metabolism and pharmacodynamics
7 Human metabolic interactions of environmental chemicals. J Biochem Mol Toxicol. 2007;21(4):182-6.
8 Mass balance, metabolic disposition, and pharmacokinetics of a single oral dose of regorafenib in healthy human subjects
9 Neurotoxicity and metabolism of the catecholamine-derived 3,4-dihydroxyphenylacetaldehyde and 3,4-dihydroxyphenylglycolaldehyde: the role of aldehyde dehydrogenase. Pharmacol Rev. 2007 Jun;59(2):125-50.
10 Methyl-hydroxylation and subsequent oxidation to produce carboxylic acid is the major metabolic pathway of tolbutamide in chimeric TK-NOG mice transplanted with human hepatocytes

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.