Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1472) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 21A2 (cyp21), Bacillus megaterium | ||||
Synonyms | Cytochrome P450 family 21 subfamily A member 2; Cytochrome cyp21A2; P450 21A2; cyp21A2 | ||||
Gene Name | cyp158a2_1 | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.14.14.16 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacillus megaterium (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MTEKTMPGPLPPVRHWPALDLKGVDFDPVLSELMREGPVTRIQLPNGEGWAWLVTRHDDV
RMVANDPRFGREAVVDQPVTRLAPHFIPARGAVGFLDPPDHTRLRRSVAAAFTARGVERV RDKARRTLDVMVDELLRIGPPADLTEAVLSPFPIAVICELMGVPADDRRGMHTWTQLILS SAHGAEVSEKAKDEMGAYFRKLIGARNDSRDEDVTSLLGAAVGRDEIDLEEAVGLAVLLQ IGGEAVTNNSGQMFYLLLTRPALADRLRSDPRIRPQAIDELLRYIPHRNMVGLSRIARED VEIRGVQIRAGDPIYVSYLAANRDPEVFPDPEHIDFGRSPNPHVAFGFGPHYCPGGMLAR LESELLVEALVDRLPGLRLAVPPSQVPFRKGALIRGPEALPVTW |
||||
Function | This enzyme is a P-450 heme-thiolate protein and it responsible for the conversion of progesterone and 17alpha-hydroxyprogesterone to their respective 21-hydroxylated derivatives, 11-deoxycorticosterone and 11-deoxycortisol. Involved in the biosynthesis of the hormones aldosterone and cortisol. The electron donor is NADPH---hemoprotein reductase. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Progesterone |
Drug Info | Approved | Premature labour | ICD11: JB00 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.