Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1112)
DME Name Carboxylic ester hydrolase (CEH), Butyrivibrio fibrisolvens
Synonyms Carboxylic ester hydrolase CEH; Acyl coenzyme A:cholesterol acyltransferase; CPT75_14810
Gene Name CEH
UniProt ID
A0A317G4I6_BUTFI
EC Number    EC: 3.1.1.1     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Carboxylic ester hydrolase
EC: 3.1.1.1
Lineage    Species: Butyrivibrio fibrisolvens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Firmicutes
Class: Clostridia
Order: Clostridiales
Family: Lachnospiraceae
Genus: Butyrivibrio
Species: Butyrivibrio fibrisolvens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut and stomach.
Sequence
MNTIIRDTDLGQIKGLELDDNTVQFRGIRYATARRFAYPEPVTSFDGIYDATRFGYACPQ
FRTYDPEDQKDPAPFYYKEFREGAEFTYDEDCLFLNIYAPKDAKKVPVIIYIHGGAFLGG
CGNENHMDGTAYARKGIIFVSINYRLGVLGFLCDRKLTKESGHSGNYGLYDQLEAIKWVH
DHIENFGGDKSNITLFGQSAGAMSIQQHCFSPLTKPYIQKVYMASGAGIGKEFAGVSPVE
DSYDYFERLTSLLGDDPEDWRQIPVKELIEKFQSVIDRDLMSHCCPHIDGLIIPKDPAQS
LEDKDYADVPYLLSTNSEDMAPQFLHQMSKDFCNTVNRNGGRAYYFYFSRKLPGDDKGAF
HSAELWYTIGSIRKCWRPMTQEDFDLSDKLVDMICEFANTGAISYSSFDTPMASFEIHP
Function This enzyme can hydrolyse vitamin A esters anh has wide specificity.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Mycophenolate mofetil
 Drug Info Approved Crohn disease ICD11: DD70 [1], [2], [3]
Mycophenolate mofetil
 Drug Info Approved Crohn disease ICD11: DD70 [3]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          1 Drugs
Alpha-linolenic acid
 Drug Info Investigative Discovery agent ICD: N.A. [4], [5]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR004811 Mycophenolate mofetil Mycophenolic acid Unclear - Unclear Mycophenolate mofetil [1], [2], [3]
MR004817 Mycophenolate mofetil N-(2-carboxymethyl)-morpholine Hydrolysis - Hydrolyzation Mycophenolate mofetil [3]
MR004818 Mycophenolate mofetil N-(2-hydroxyethyl)-morpholine Unclear - Unclear Mycophenolate mofetil [3]
MR004819 Mycophenolate mofetil N-(2-hydroxyethyl)-morpholine N-oxide Unclear - Unclear Mycophenolate mofetil [3]
References
1 The emergence of mycophenolate mofetilin dermatology: from its roots in the world of organ transplantation to its versatile role in the dermatology treatment room
2 The evolution of population pharmacokinetic models to describe the enterohepatic recycling of mycophenolic acid in solid organ transplantation and autoimmune disease. Clin Pharmacokinet. 2011 Jan;50(1):1-24.
3 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
4 Immunogenic inhibition of prominent ruminal bacteria as a means to reduce lipolysis and biohydrogenation activity in vitro. Food Chem. 2017 Mar 1;218:372-377.
5 Cell-associated alpha-amylases of butyrate-producing Firmicute bacteria from the human colon. Microbiology. 2006 Nov;152(Pt 11):3281-3290.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.