General Information of DME (ID: DME0202)
DME Name Fatty acid desaturase 1 (FADS1), Homo sapiens
Synonyms Acyl-CoA (8-3)-desaturase; Delta(5) desaturase; Delta(5) fatty acid desaturase; Delta-5 desaturase; D5D; FADS1; FADSD5
Gene Name FADS1
UniProt ID
FADS1_HUMAN
Gene ID
3992
EC Number    EC: 1.14.19.44     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Oxygen paired donor oxidoreductase
EC: 1.14.19.44
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVIS
HYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVE
RMGLMKANHVFFLLYLLHILLLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHD
FGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFA
LGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVIQRKKWVDLAWMI
TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQL
QATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
SAFADIIHSLKESGQLWLDAYLHQ
Pathway Biosynthesis of unsaturated fatty acids (hsa01040 )
Fatty acid metabolism (hsa01212 )
Metabolic pathways (hsa01100 )
Function This enzyme acts as a front-end fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 5 located between a preexisting double bond and the carboxyl end of the fatty acyl chain. It is involved in biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors. Specifically, it desaturates dihomo-gamma-linoleoate (DGLA) (20:3n-6) and eicosatetraenoate (ETA) (20:4n-3) to generate arachidonate (AA) (20:4n-6) and eicosapentaenoate (EPA) (20:5n-3), respectively. As a rate limiting enzyme for DGLA (20:3n-6) and AA (20:4n-6)-derived eicosanoid biosynthesis, it controls the metabolism of inflammatory lipids like prostaglandin E2.
Full List of Drug(s) Metabolized by This DME
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Gamma-linolenic acid
Drug Info Phase 4 Neurodermatitis ICD11: EA83 [1]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Omega-6-FA
Drug Info Phase 3 Attention deficit hyperactivity disorder ICD11: 6A05 [2]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          1 Drugs
Alpha-linolenic acid
Drug Info Investigative Discovery agent ICD: N.A. [3]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR004146 20:4n-3 20:5n-3 Other reaction - Desaturation Alpha-linolenic acid [3]
MR007207 Dihomo-gamma-linolenic acid Arachidonic Acid Other reaction - Delta-5-desaturation Gamma-linolenic acid [1]
MR006390 Dihomo-gamma-linolenic acid Arachidonic acid Multi-steps Reaction - Elongation; desaturation Omega-6-FA [2]
References
1 Gamma-linolenic acid, Dihommo-gamma linolenic, Eicosanoids and Inflammatory Processes
2 Health implications of high dietary omega-6 polyunsaturated Fatty acids. J Nutr Metab. 2012;2012:539426.
3 Metabolism of alpha-linolenic acid in humans

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.