Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1024) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Klebsiella variicola | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Beta-lactamase SHV-2; SHV-2A; bla; shv2 | ||||
Gene Name | bla | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Klebsiella variicola (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human lung. | ||||
Sequence |
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARG IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR |
||||
Function | This enzyme hydrolyzes cefotaxime, ceftazidime and other broad spectrum cephalosporins. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 4 Drugs | ||||
Cefotaxime |
Drug Info | Approved | Meningitis | ICD11: 1A62 | [1], [2] |
Aztreonam |
Drug Info | Approved | Cystic fibrosis | ICD11: CA25 | [1] |
Cefoxitin |
Drug Info | Approved | Peritonitis | ICD11: DC50 | [1], [2] |
Ceftriaxone |
Drug Info | Approved | Methicillin-resistant staphylococcus infection | ICD11: 1D01 | [1] |
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Cefpirome |
Drug Info | Phase 4 | Pseudomonas infection | ICD11: 1G40 | [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.