Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1035)
DME Name Cardiac glycoside reductase 1 (cgr1), Eggerthella lenta
Synonyms Cardiac glycoside reductase operon protein 1; Cytochrome c-type protein Cgr1; cgr1
Gene Name cgr1
UniProt ID
CGR1_EGGLE
Gene ID
40923313
EC Number    EC: 1.3.2.-     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-CH donor oxidoreductase
Quinone acceptor oxidoreductase
EC: 1.3.2.-
Lineage    Species: Eggerthella lenta     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Actinobacteria
Class: Coriobacteriia
Order: Eggerthellales
Family: Eggerthellaceae
Genus: Eggerthella
Species: Eggerthella lenta
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MAEEPVVIGDPAPRTRKWPIVVGVVVVVLIAAGAGFWVWHEQPSFCAAICHTPMDEYLET
YEQEAGTAGVDKWGNEVANTNAMLAVSHKAQGKDCMACHVPTLSEQMSEGMNWVTGNYVY
PLEERDTEMLTEARGVDADEFCLNESCHNLTRDDLIKATSDMEFNPHQPQHGEIECSECH
KAHRASVMYCTQCHSEAEVPEGWLTVAEANKLSTAA
Function This enzyme anchors as a dimer in the cytoplasmic membrane and shuttles quinone derived electrons to associated periplasmic nitrite reductases.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Digoxin
 Drug Info Approved Cardiac arrhythmia ICD11: BC65 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000856 Digoxin Dihydrodigoxin Reduction - Reduction Digoxin [1], [2]
References
1 Mechanistic insight into digoxin inactivation by Eggerthella lenta augments our understanding of its pharmacokinetics. Gut Microbes. 2014 Mar-Apr;5(2):233-8.
2 American Society of Health System Pharmacists; AHFS Drug Information 2010. Bethesda, MD. (2010), p. 2511

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.