Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1096) | |||||
---|---|---|---|---|---|
DME Name | Azoreductase (azoR), Escherichia coli | ||||
Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; JW1409; acpD; b1412 | ||||
Gene Name | azoR | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Escherichia coli (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALR
PSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFR YTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYG PEMAAKAQSDAKAAIDSIVSA |
||||
Structure | |||||
Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. And it requires NADH, but not NADPH, as an electron donor for its activity. And it can reduce ethyl red and methyl red, but is not able to convert sulfonated azo dyes. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Balsalazide |
Drug Info | Approved | Ulcerative colitis | ICD11: DD71 | [1] |
Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
CTK0H-9987 |
Drug Info | Phase 2 | Trachoma | ICD11: 1C23 | [2] |
SC-47085 |
Drug Info | Phase 2 | Ankylosing spondylitis | ICD11: FA92 | [3] |
Discontinued/withdrawn Drugs | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
CBL-954 |
Drug Info | Discontinued | Hepatocellular carcinoma | ICD11: 2C12 | [4] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ipsalazide |
Drug Info | Investigative | Inflammatory bowel disease | ICD11: DD72 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.