Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1349)
DME Name Beta-lactamase (blaB), Bifidobacterium breve
Synonyms Penicillinase; Cephalosporinase; Beta-lactam; BBRI4_5c12
Gene Name blaB
UniProt ID
A0A0L0LVQ7_BIFBR
EC Number    EC: 3.5.2.6     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-nitrogen hydrolase
Cyclic amide hydrolase
EC: 3.5.2.6
Lineage    Species: Bifidobacterium breve     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Actinobacteria
Class: Actinobacteria
Order: Bifidobacteriales
Family: Bifidobacteriaceae
Genus: Bifidobacterium
Species: Bifidobacterium breve
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MPRSVSSSSYPHEYSRHASHAAKPHRPHPQPCKPRQLRLDWQALLRFFQNLSERLPQRHH
GKVKILKGSVYTRRRIVVGCLGVLLLVELFQLFWPSDKFFPLATLDGHAVGGQSSQQAAE
TLNAATLKRTVKLTDKTTGTTVSLTAKQAGITVDYTDRAKAAAKHSVVKRIVPFSWLFVH
STTSDSLPDALGTSDKQAHEDMRNASVQGTKGELKIVSAAPGYTFTSADIRSAAGSSFSS
SATGDLAAATIEMGIVSPTVSDDTAEQLLDTLNKALSKDVTFTYEDGTWTVPAKKIINTV
STTVNAQDNTKLDVTISESKLMRQLKSKGIALKVAKKAADAGVTPATIAVKGSAYQVIDA
SATAASLSGMLASGQNAPVAVSTKDFSNVELYEGLPASGTIEEKLQQLFGDADYEVAVYD
LKTGKSKIQIDADTAMTSASTYKLFIAYSMIHAVETGQVTWDSALNGMTLSSCMATMIIN
SDNSCPEAWLARYGFSTVTQQAHDIGAANTNFVPYGMTTTANDLATVLKGFYSNSIASPD
STDQLFSLMETQVYREGIPAGIGSDGVVQDKVGFMDGLLHDAAIVRSDKGDYAMVIMTDG
SSWNKIAQASLLIYESL
Function This enzyme hydrolyzes beta-lactam.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Cefoxitin
 Drug Info Approved Peritonitis ICD11: DC50 [1]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          1 Drugs
Ceftiofur
 Drug Info Investigative Superficial thrombophlebitis ICD11: BD70 [2], [3]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000223 Ampicillin Ampicillin penicilloic acid Unclear - Unclear Ampicillin [4], [5]
MR000224 Ampicillin 5R,6R-penicilloic acid Unclear - Unclear Ampicillin [4], [5]
MR000225 Ampicillin 5S,6R-penicilloic acid Unclear - Unclear Ampicillin [4], [5]
MR000226 Ampicillin Ampicillin piperazine-2,5- dione Unclear - Unclear Ampicillin [4], [5]
MR000583 Cefotaxime Desacetyl-cefotaxime Oxidation - Deacetylation Cefotaxime [6], [7]
MR000584 Cefoxitin Decarbamylcefoxitin Unclear - Unclear Cefoxitin [1]
MR000929 Ertapenem Ertapenem metabolite M1 Unclear - Unclear Ertapenem [8]
MR002057 Piperacillin Desethyl-piperacillin Oxidation - N-Dealkylation Piperacillin [9], [10], [11]
⏷ Show the Full List of 8 MR(s)
References
1 Analysis of cefoxitin, cephalothin and their deacylated metabolites in human urine by high-performance liquid chromatography J Chromatogr. 1974 Nov 6;99(0):609-18. doi: 10.1016/s0021-9673(00)90889-6.
2 Bovine intestinal bacteria inactivate and degrade ceftiofur and ceftriaxone with multiple beta-lactamases. Antimicrob Agents Chemother. 2011 Nov;55(11):4990-8.
3 Characterization and induction of prophages in human gut-associated Bifidobacterium hosts. Sci Rep. 2018 Aug 24;8(1):12772.
4 Liquid chromatographic determination of ampicillin and its metabolites in human urine by postcolumn alkaline degradation J Pharm Pharmacol. 1987 Jan;39(1):5-8. doi: 10.1111/j.2042-7158.1987.tb07152.x.
5 Identification of metabolites of ampicillin using liquid chromatography/thermospray mass spectrometry and fast atom bombardment tandem mass spectrometry Biomed Environ Mass Spectrom. 1989 Nov;18(11):983-94. doi: 10.1002/bms.1200181106.
6 Metabolism of cefotaxime in animals and humans Rev Infect Dis. 1982 Sep-Oct;4 Suppl:S325-32. doi: 10.1093/clinids/4.supplement_2.s325.
7 Molecularly Imprinted Polymers as Solid-Phase Microextraction Fibers for the Isolation of Selected Antibiotics from Human Plasma. Materials (Basel). 2021 Aug 27;14(17):4886. doi: 10.3390/ma14174886.
8 Pharmacokinetics and pharmacodynamics of ertapenem: an overview for clinicians J Antimicrob Chemother. 2004 Jun;53 Suppl 2:ii23-8. doi: 10.1093/jac/dkh205.
9 The formation of desethyl-piperacillin from piperacillin by human liver S9 in vitro Biopharm Drug Dispos. 1997 Apr;18(3):185-90. doi: 10.1002/(sici)1099-081x(199704)18:3<185::aid-bdd10>3.0.co;2-u.
10 Determination of the antibiotic resistance rates of Serratia marcescens isolates obtained from various clinical specimens. Niger J Clin Pract. 2019 Jan;22(1):125-130.
11 In vitro and in vivo determination of piperacillin metabolism in humans Drug Metab Dispos. 2007 Mar;35(3):345-9. doi: 10.1124/dmd.106.012278.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.