Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1023) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Klebsiella pneumoniae | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; bla_2; NCTC5046_06338 | ||||
Gene Name | bla_2 | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Klebsiella pneumoniae (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human lung. | ||||
Sequence |
MVMRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRA
DERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGEL CAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPRRRPATPL PRPAWPRPCASC |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 5 Drugs | ||||
Levofloxacin |
Drug Info | Approved | Bronchitis | ICD11: CA20 | [1] |
Cefotaxime |
Drug Info | Approved | Meningitis | ICD11: 1A62 | [1] |
Aztreonam |
Drug Info | Approved | Cystic fibrosis | ICD11: CA25 | [1] |
Cefoxitin |
Drug Info | Approved | Peritonitis | ICD11: DC50 | [1] |
Cefazolin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Cotrimoxazole |
Drug Info | Phase 4 | Human immunodeficiency virus infection | ICD11: 1C60 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Analysis of the drug-resistant characteristics of Klebsiella pneumoniae isolated from the respiratory tract and CTX-M ESBL genes. Genet Mol Res. 2015 Oct 5;14(4):12043-8. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.