Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1077)
DME Name NADPH-dependent curcumin reductase (curA), Escherichia coli
Synonyms NADPH-dependent curcumin/dihydrocurcumin reductase; b1449; JW5907; curA; yncB
Gene Name curA
UniProt ID
CURA_ECOLI
Gene ID
946012
EC Number    EC: 1.3.1.-     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.-
Lineage    Species: Escherichia coli     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MGQQKQRNRRWVLASRPHGAPVPENFRLEEDDVATPGEGQVLLRTVYLSLDPYMRGRMSD
EPSYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLGYSGWQDYDISSGDDLVKLGDHP
QNPSWSLGVLGMPGFTAYMGLLDIGQPKEGETLVVAAATGPVGATVGQIGKLKGCRVVGV
AGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIYYENVGGKVFDAVLPLLNT
SARIPVCGLVSSYNATELPPGPDRLPLLMATVLKKRIRLQGFIIAQDYGHRIHEFQREMG
QWVKEDKIHYREEITDGLENAPQTFIGLLKGKNFGKVVIRVAGDD
Function This enzyme catalyzes the metal-independent reduction of curcumin to dihydrocurcumin (DHC) as an intermediate product, followed by further reduction to tetrahydrocurcumin (THC) as an end product. And the enzyme also acts on 3-octene-2-one, 3-hepten-2-one, resveratrol, and trans-2-octenal.
Full List of Drug(s) Metabolized by This DME
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          2 Drugs
Curcumin
 Drug Info Phase 3 Stomach cancer ICD11: 2B72 [1]
SRT-501
 Drug Info Phase 3 Nephroptosis ICD11: GB90 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR009669 Curcumin Dihydrocurcumin Reduction - Reduction Curcumin [2], [3], [4]
MR009673 Dihydrocurcumin Tetrahydrocurcumin Reduction - Reduction Curcumin [2], [3], [4]
References
1 Discovery of the curcumin metabolic pathway involving a unique enzyme in an intestinal microorganism. Proc Natl Acad Sci U S A. 2011 Apr 19;108(16):6615-20.
2 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
3 Curcumin, Gut Microbiota, and Neuroprotection
4 Curcumin and Weight Loss: Does It Work?

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.