Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN096) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 3A1 (Cyp3a1), Rattus norvegicus | ||||
| Gene Name | Cyp3a1 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Rattus norvegicus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWKF
DVECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAVSV AKDEEWKRYRALLSPTFTSGRLKEMFPIIEQYGDILVKYLKQEAETGKPVTMKKVFGAYS MDVITSTSFGVNVDSLNNPKDPFVEKTKKLLRFDFFDPLFLSVVLFPFLTPIYEMLNICM FPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQS IIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMV LNETLRLYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERF SKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSR QGLLQPTKPIILKVVPRDEIITGS |
||||
| Function | Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Metformin |
Drug Info | Approved | Type-2 diabetes | ICD11: 5A11 | [1] |
Terazosin |
Drug Info | Approved | Prostatic hyperplasia | ICD11: GA90 | [2] |
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
AG-1549 |
Drug Info | Phase 1 | Human immunodeficiency virus infection | ICD11: 1C60 | [3] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Pharmacokinetic interaction between DA-8159, a new erectogenic, and metformin in rats: competitive inhibition of metabolism via hepatic CYP3A1/2 | ||||
| 2 | Pharmacokinetic and pharmacodynamic consequences of inhibition of terazosin metabolism via CYP3A1 and/or 3A2 by DA-8159, an erectogenic, in rats | ||||
| 3 | Evaluation of capravirine as a CYP3A probe substrate: in vitro and in vivo metabolism of capravirine in rats and dogs | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

