Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0063)
DME Name Sulfotransferase 1A3 (SULT1A3), Homo sapiens
Synonyms Sulfotransferase family cytosolic 1A member 3; Aryl sulfotransferase 1A3; Aryl sulfotransferase 3; Aryl sulfotransferase 1A3/1A4; Catecholamine-sulfating phenol sulfotransferase; Monoamine-sulfating phenol sulfotransferase; Placental estrogen sulfotransferase; Sulfotransferase 1A3/1A4; Monoamine-preferring sulfotransferase; TL-PST; Thermolabile phenol sulfotransferase; HAST3; M-PST; ST1A3; STM; SULT1A3
Gene Name SULT1A3
UniProt ID
ST1A3_HUMAN
Gene ID
6818
EC Number    EC: 2.8.2.1     (Click to Show/Hide the Complete EC Tree)
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.1
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDM
IYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLD
QKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNY
TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Structure
1CJM ; 2A3R
Pathway Chemical carcinogenesis (hsa05204 )
Function This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:        11 Drugs
Levodopa
 Drug Info Approved Parkinsonism ICD11: 8A00 [1]
Ethinyl estradiol
 Drug Info Approved Menopausal disorder ICD11: GA30 [2]
Opicapone
 Drug Info Approved Parkinsonism ICD11: 8A00 [3]
Rotigotine
 Drug Info Approved Parkinsonism ICD11: 8A00 [4]
Tapentadol
 Drug Info Approved Neuropathic pain ICD11: 8E43 [5]
Acetaminophen
 Drug Info Approved Anaesthesia ICD11: 8E22 [6]
Salbutamol
 Drug Info Approved Chronic obstructive pulmonary disease ICD11: CA22 [7]
Phenylephrine
 Drug Info Approved Fecal incontinence ICD11: ME07 [8]
Ritodrine
 Drug Info Approved Premature labour ICD11: JB00 [9], [10]
Levalbuterol
 Drug Info Approved Asthma ICD11: CA23 [11]
Neupro
 Drug Info Phase 4 Restless legs syndrome ICD11: 7A80 [4]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000049 Acetaminophen Acetaminophen sulfate Conjugation - Sulfation Acetaminophen [6], [12], [13]
MR013589 Epigallocatechin gallate EGCG-4''-Sulfate Unclear - Unclear Epigallocatechin gallate [14]
MR002846 Epinephrine hydrochloride Epinephrine sulfate metabolite Conjugation - Sulfation Epinephrine hydrochloride [15]
MR002726 Ethinyl estradiol Ethinylestradiol-3-sulfate Conjugation - Sulfation Ethinyl estradiol [2]
MR002727 Ethinyl estradiol Ethinylestradiol-3,17-sulfate Conjugation - Sulfation Ethinyl estradiol [16]
MR002728 Ethinyl estradiol Ethinylestradiol-17-sulfate Conjugation - Sulfation Ethinyl estradiol [16]
MR001490 Dopamine Dopamine-3-O-sulfate Conjugation - Sulfation Levodopa [1]
MR001491 Dopamine Dopamine-4-O-sulfate Conjugation - Sulfation Levodopa [1]
MR001650 17alpha-Ethinylestradiol Ethinylestradiol-3-sulfate Conjugation - Sulfation Mestranol [2]
MR009262 Neupro Neupro Metabolite M5 Unclear - Unclear Neupro [17], [4]
MR013704 Opicapone BIA 9-1103 Conjugation - Sulfation Opicapone [18]
MR002013 Acetaminophen Acetaminophen sulfate Unclear - Unclear Phenacetin [19]
MR005748 Ritodrine Ritodrine sulfated Conjugation - Sulfation Ritodrine [9], [10]
MR002218 Salbutamol Rac albuterol-4-sulfate Unclear - Unclear Salbutamol [7]
MR002337 Tapentadol Tapentadol-O-glucuronide Conjugation - Conjugation Tapentadol [20], [21]
⏷ Show the Full List of 15 MR(s)
References
1 DrugBank(Pharmacology-Metabolism)Levodopa
2 Sulfotransferase 1E1 is a low km isoform mediating the 3-O-sulfation of ethinyl estradiol Drug Metab Dispos. 2004 Nov;32(11):1299-303. doi: 10.1124/dmd.32.11..
3 Metabolism and disposition of opicapone in the rat and metabolic enzymes phenotyping
4 Identification of the human SULT enzymes involved in the metabolism of rotigotine. J Clin Pharmacol. 2016 Jun;56(6):754-60.
5 On the Molecular Basis Underlying the Metabolism of Tapentadol Through Sulfation Eur J Drug Metab Pharmacokinet. 2017 Oct;42(5):793-800. doi: 10.1007/s13318-016-0392-8.
6 Simultaneous quantification of abemaciclib and its active metabolites in human and mouse plasma by UHPLC-MS/MS J Pharm Biomed Anal. 2021 Sep 5;203:114225. doi: 10.1016/j.jpba.2021.114225.
7 SULT 1A3 single-nucleotide polymorphism and the single dose pharmacokinetics of inhaled salbutamol enantiomers: are some athletes at risk of higher urine levels? Drug Test Anal. 2015 Feb;7(2):109-13.
8 Impact of SULT1A3/SULT1A4 genetic polymorphisms on the sulfation of phenylephrine and salbutamol by human SULT1A3 allozymes
9 Metabolism and disposition of ritodrine in a pregnant baboon
10 Inhibitory effects of various beverages on ritodrine sulfation by recombinant human sulfotransferase isoforms SULT1A1 and SULT1A3. Pharm Res. 2005 Aug;22(8):1406-10.
11 LABEL:Levalbuterol
12 Application of a Volumetric Absorptive Microsampling (VAMS)-Based Method for the Determination of Paracetamol and Four of its Metabolites as a Tool for Pharmacokinetic Studies in Obese and Non-Obese Patients. Clin Pharmacokinet. 2022 Dec;61(12):1719-1733. doi: 10.1007/s40262-022-01187-2.
13 Evaluation of urinary acetaminophen metabolites and its association with the genetic polymorphisms of the metabolising enzymes, and serum acetaminophen concentrations in preterm neonates with patent ductus arteriosus. Xenobiotica. 2021 Nov;51(11):1335-1342. doi: 10.1080/00498254.2021.1982070.
14 4-Sulfation Is the Major Metabolic Pathway of Epigallocatechin-3-gallate in Humans: Characterization of Metabolites, Enzymatic Analysis, and Pharmacokinetic Profiling
15 Crystal structure of human sulfotransferase SULT1A3 in complex with dopamine and 3'-phosphoadenosine 5'-phosphate. Biochem Biophys Res Commun. 2005 Sep 23;335(2):417-23.
16 The pharmacokinetics and metabolism of ethinyl estradiol and its three sulfates in the baboon Am J Obstet Gynecol. 1983 May 1;146(1):80-7. doi: 10.1016/0002-9378(83)90931-6.
17 Absorption, disposition, metabolic fate, and elimination of the dopamine agonist rotigotine in man: administration by intravenous infusion or transdermal delivery
18 Pharmacokinetics, pharmacodynamics and tolerability of opicapone, a novel catechol-O-methyltransferase inhibitor, in healthy subjects: prediction of slow enzyme-inhibitor complex dissociation of a short-living and very long-acting inhibitor
19 DrugBank(Pharmacology-Metabolism)Phenacetin
20 Investigations into the drug-drug interaction potential of tapentadol in human liver microsomes and fresh human hepatocytes. Drug Metab Lett. 2008 Jan;2(1):67-75.
21 In vitro and in vivo characterization of tapentadol metabolites Methods Find Exp Clin Pharmacol. 2010 Jan-Feb;32(1):31-8. doi: 10.1358/mf.2010.32.1.1434165.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.