Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0066)
DME Name	UDP-glucuronosyltransferase 2B17 (UGT2B17), Homo sapiens
Synonyms	UDP-glucuronosyltransferase family 2 member B17; C19-steroid-specific UDP-glucuronosyltransferase; C19-steroid-specific UDPGT; UDPGT 2B17; UGT2B17
Gene Name	UGT2B17
UniProt ID	UDB17_HUMAN
Gene ID	7367
EC Number	EC: 2.4.1.17 (Click to Show/Hide the Complete EC Tree) Transferase Glycosyltransferases Hexosyltransferase EC: 2.4.1.17
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSA SILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEY SDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYT VEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEV LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT MSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA AHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
Pathway	Ascorbate and aldarate metabolism (hsa00053 )
	Chemical carcinogenesis (hsa05204 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Drug metabolism - other enzymes (hsa00983 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Pentose and glucuronate interconversions (hsa00040 )
	Porphyrin and chlorophyll metabolism (hsa00860 )
	Retinol metabolism (hsa00830 )
	Steroid hormone biosynthesis (hsa00140 )
Function	This enzyme has a major substrates eugenol > 4-methylumbelliferone > dihydrotestosterone (DHT) > androstane-3-alpha,17-beta-diol (3-alpha-diol) > testosterone > androsterone (ADT).

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 10 Drugs
Darolutamide	Drug Info	Approved	Prostate cancer	ICD11: 2C82	[1]
Cannabidiol	Drug Info	Approved	Lennox-Gastaut syndrome	ICD11: 8A62	[2]
Dextromethorphan hydrobromide	Drug Info	Approved	Atherosclerosis	ICD11: BA80	[3]
Desvenlafaxine	Drug Info	Approved	Major depressive disorder	ICD11: 6A70-6A7Z	[4]
Eslicarbazepine acetate	Drug Info	Approved	Epilepsy	ICD11: 8A60	[5]
Losartan potassium	Drug Info	Approved	Essential hypertension	ICD11: BA00	[6]
Edaravone	Drug Info	Approved	Cerebral stroke	ICD11: 8B11	[7]
Megestrol acetate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[8]
Vorinostat	Drug Info	Approved	Cutaneous T-cell lymphoma	ICD11: 2B01	[9]
Testosterone	Drug Info	Approved	Osteoporosis	ICD11: FB83	[10]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
Denopamine	Drug Info	Phase 4	Congestive heart failure	ICD11: BD10	[11]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 4 Drugs
ABL001	Drug Info	Phase 3	Chronic myelogenous leukaemia	ICD11: 2A20	[12]
Heroin	Drug Info	Phase 3	Opiate dependence	ICD11: 6C43	[13]
Fevipiprant	Drug Info	Phase 3	Asthma	ICD11: CA23	[14]
PT2977	Drug Info	Phase 3	Renal cell carcinoma	ICD11: 2C90	[15]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
PT2385	Drug Info	Phase 2	Von hippel-lindau disease	ICD11: 5A75	[16]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
MK-7246	Drug Info	Phase 1	Asthma	ICD11: CA23	[17]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 3 Drugs
Hydroxybenzo(a)pyrene	Drug Info	Investigative	Discovery agent	ICD: N.A.	[18]
Hydroxybenzo[a]pyrene	Drug Info	Investigative	Discovery agent	ICD: N.A.	[18]
BRN-1980310	Drug Info	Investigative	Discovery agent	ICD: N.A.	[18]
Experimental Enzyme Kinetic Data of Drugs			Click to Show/Hide the Full List of Drugs: 4 Drugs
Denopamine	Drug Info	Phase 4	Congestive heart failure	Km = 1.48 microM	[11]
Hydroxybenzo(a)pyrene	Drug Info	Investigative	Discovery agent	Km = 0.0097 microM	[18]
Hydroxybenzo[a]pyrene	Drug Info	Investigative	Discovery agent	Km = 0.0113 microM	[18]
BRN-1980310	Drug Info	Investigative	Discovery agent	Km = 0.0301 microM	[18]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR005421	ABL001	Asciminib metabolite M30.5	Conjugation - Glucuronidation	ABL001	[19]
MR000815	3-hydroxymorphinan	3-hydroxymorphinan O-glucuronide	Conjugation - Glucuronidation	Dextromethorphan hydrobromide	[20], [21]
MR000815	3-hydroxymorphinan	3-hydroxymorphinan O-glucuronide	Conjugation - Glucuronidation	Dextromethorphan hydrobromide	[22], [21]
MR000813	Dextrorphan	Dextrorphan O-glucuronide	Conjugation - Glucuronidation	Dextromethorphan hydrobromide	[20], [23], [24]
MR000896	Edaravone	Edaravone glucuronide conjugates	Conjugation - Glucuronidation	Edaravone	[7]
MR012009	Fevipiprant	AG met	Unclear - Unclear	Fevipiprant	[14], [25]
MR013333	Morphine	Morphine-3-glucuronide	Conjugation - Glucuronidation	Heroin	[13]
MR006915	Losartan potassium	Losartan N2-glucuronide	Conjugation - N-glucuronidation	Losartan potassium	[6]
MR001634	Megestrol acetate metabolite M1	Megestrol acetate metabolite MG1	Conjugation - Glucuronidation	Megestrol acetate	[26]
MR001635	Megestrol acetate metabolite M2	Megestrol acetate metabolite MG2	Conjugation - Glucuronidation	Megestrol acetate	[26]
MR003964	MK-7246	MK-7246 Metabolite M3	Conjugation - Glucuronidation	MK-7246	[17]
MR008871	Osilodrostat	Osilodrostat glucuronide	Unclear - Unclear	Osilodrostat	[27]
MR013651	PT2385	PT2385 M8	Conjugation - Glucuronide conjugation	PT2385	[16]
MR013649	PT2385 M10	PT2385 M1	Multi-steps Reaction - Hydroxylation; Glucuronide conjugation	PT2385	[16]
MR013647	PT2385 M2	PT2385 M11	Multi-steps Reaction - Hydroxylation; Glucuronide conjugation	PT2385	[16]
MR013643	PT2385 M7	PT2385 M12	Multi-steps Reaction - Oxidative Defluorination; Glucuronide conjugation	PT2385	[16]
MR005431	PT2977	Unclear	Unclear - Unclear	PT2977	[28]
MR005667	Vorinostat	Vorinostat-O-Glucuronide metabolite	Unclear - Unclear	Vorinostat	[29], [30]


⏷ Show the Full List of 18 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.75E-12; Fold-change: 7.07E-01; Z-score: 1.30E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.79E-02; Fold-change: 1.80E-01; Z-score: 1.75E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.17E-01; Fold-change: -6.44E-02; Z-score: -7.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.04E-02; Fold-change: -1.22E-02; Z-score: -4.53E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.05E-01; Fold-change: -5.04E-02; Z-score: -3.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.21E-01; Fold-change: 3.35E-02; Z-score: 2.38E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.35E-01; Fold-change: -6.39E-02; Z-score: -2.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.33E-02; Fold-change: 9.46E-03; Z-score: 4.73E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.92E-03; Fold-change: 1.33E-01; Z-score: 4.19E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.33E-01; Fold-change: -5.48E-02; Z-score: -3.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.93E-02; Fold-change: -1.38E-01; Z-score: -7.21E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.26E-01; Fold-change: 1.79E-01; Z-score: 7.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.95E-07; Fold-change: 2.12E-01; Z-score: 9.57E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.41E-01; Fold-change: -8.00E-02; Z-score: -6.38E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.32E-01; Fold-change: -3.08E-02; Z-score: -1.96E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.42E-01; Fold-change: -3.24E-02; Z-score: -8.63E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.27E-01; Fold-change: 1.02E-01; Z-score: 5.57E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.11E-03; Fold-change: 1.46E+00; Z-score: 1.84E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.57E-03; Fold-change: -8.31E-03; Z-score: -1.93E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.02E-02; Fold-change: 1.06E-01; Z-score: 2.70E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.98E-01; Fold-change: -3.99E-02; Z-score: -8.63E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.63E-04; Fold-change: 1.22E-01; Z-score: 1.58E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.36E-03; Fold-change: 1.00E-01; Z-score: 7.34E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.53E-01; Fold-change: 1.02E-01; Z-score: 5.62E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.50E-26; Fold-change: -7.40E+00; Z-score: -1.89E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.29E-19; Fold-change: -7.40E+00; Z-score: -1.82E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.35E-02; Fold-change: -8.68E+00; Z-score: -2.34E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.66E-21; Fold-change: -8.24E+00; Z-score: -1.77E+01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.09E-01; Fold-change: -4.31E-01; Z-score: -2.99E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.39E-01; Fold-change: -5.50E-02; Z-score: -2.15E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.75E-04; Fold-change: -2.39E+00; Z-score: -7.87E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.79E-01; Fold-change: -3.74E-01; Z-score: -1.67E-01
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 5.62E-01; Fold-change: -2.40E+00; Z-score: -7.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.95E-10; Fold-change: 5.44E-02; Z-score: 2.04E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.24E-19; Fold-change: 1.38E-01; Z-score: 6.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.75E-01; Fold-change: -2.95E-02; Z-score: -1.24E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.64E-20; Fold-change: 1.79E-01; Z-score: 9.73E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.06E-24; Fold-change: 2.05E-01; Z-score: 1.14E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.03E-01; Fold-change: -1.26E-01; Z-score: -2.16E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.01E-01; Fold-change: -1.20E-01; Z-score: -1.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.88E-04; Fold-change: 5.05E-02; Z-score: 2.28E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.15E-04; Fold-change: 5.61E-02; Z-score: 1.94E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.16E-02; Fold-change: -4.54E-01; Z-score: -3.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.80E-01; Fold-change: -6.06E-02; Z-score: -4.43E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.78E-17; Fold-change: 3.85E-01; Z-score: 4.74E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.64E-01; Fold-change: -4.66E-03; Z-score: -2.63E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.78E-01; Fold-change: 6.06E-02; Z-score: 2.15E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.47E-01; Fold-change: -1.20E-01; Z-score: -6.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.78E-01; Fold-change: -1.13E-02; Z-score: -7.81E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.72E-03; Fold-change: 2.37E-01; Z-score: 7.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.09E-01; Fold-change: -1.02E-01; Z-score: -9.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.01E-01; Fold-change: -7.54E-03; Z-score: -1.59E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.53E-01; Fold-change: 6.28E-02; Z-score: 1.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.72E-01; Fold-change: 1.18E-02; Z-score: 1.92E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.44E-01; Fold-change: -3.14E-02; Z-score: -1.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.51E-01; Fold-change: -2.05E-02; Z-score: -1.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.86E-05; Fold-change: 6.08E-02; Z-score: 2.79E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.15E-01; Fold-change: -1.27E-01; Z-score: -9.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.65E-02; Fold-change: 2.42E-01; Z-score: 1.12E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.21E-03; Fold-change: 1.86E-01; Z-score: 7.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.43E-01; Fold-change: 0.00E+00; Z-score: 0.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.92E-01; Fold-change: 3.87E-02; Z-score: 4.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.99E-01; Fold-change: -7.41E-02; Z-score: -1.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.85E-01; Fold-change: 9.52E-03; Z-score: 7.29E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.39E-01; Fold-change: 3.48E-01; Z-score: 1.10E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.35E-01; Fold-change: 5.35E-02; Z-score: 1.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.62E-01; Fold-change: 4.77E-02; Z-score: 1.79E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.28E-01; Fold-change: -5.03E-02; Z-score: -5.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.93E-03; Fold-change: 1.63E-01; Z-score: 2.26E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.02E-01; Fold-change: -1.60E+00; Z-score: -4.84E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.84E-01; Fold-change: -1.58E-02; Z-score: -5.41E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.82E-01; Fold-change: 7.54E-02; Z-score: 3.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.96E-02; Fold-change: -1.11E+00; Z-score: -1.03E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.01E-01; Fold-change: -3.33E-02; Z-score: -4.09E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.66E-03; Fold-change: -2.11E-01; Z-score: -8.56E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.69E-01; Fold-change: -1.99E-02; Z-score: -7.31E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.36E-02; Fold-change: 2.83E-02; Z-score: 9.35E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.87E-01; Fold-change: -8.53E-03; Z-score: -6.55E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.78E-02; Fold-change: -7.68E-02; Z-score: -8.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.20E-01; Fold-change: -8.78E-03; Z-score: -2.07E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.81E-02; Fold-change: -2.95E-02; Z-score: -3.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.93E-01; Fold-change: 3.92E-02; Z-score: 5.10E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.42E-01; Fold-change: 4.84E-03; Z-score: 3.37E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.78E-02; Fold-change: 2.50E-02; Z-score: 1.84E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.71E-01; Fold-change: 9.67E-02; Z-score: 1.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.98E-01; Fold-change: -4.52E-03; Z-score: -2.33E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.93E-01; Fold-change: -1.27E-02; Z-score: -7.56E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 3.29E-01; Fold-change: 1.29E-01; Z-score: 6.22E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.21E-01; Fold-change: -5.28E-02; Z-score: -2.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.00E-01; Fold-change: -8.01E-02; Z-score: -7.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.41E-01; Fold-change: -7.71E-02; Z-score: -8.54E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.15E-01; Fold-change: 6.29E-02; Z-score: 2.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.27E-01; Fold-change: -1.79E-02; Z-score: -7.03E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.83E-03; Fold-change: 1.95E-01; Z-score: 1.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.34E-01; Fold-change: -6.20E-02; Z-score: -1.46E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.62E-01; Fold-change: 1.33E-02; Z-score: 9.61E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.04E-02; Fold-change: 3.70E-01; Z-score: 3.24E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.73E-01; Fold-change: -2.56E-02; Z-score: -2.65E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.67E-01; Fold-change: -7.79E-02; Z-score: -3.59E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.22E-01; Fold-change: -6.59E-02; Z-score: -7.83E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.44E-01; Fold-change: 1.52E-01; Z-score: 3.75E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.16E-03; Fold-change: 1.25E-01; Z-score: 3.53E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.33E-02; Fold-change: 1.44E-01; Z-score: 1.06E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.41E-01; Fold-change: 2.23E-02; Z-score: 2.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.74E-01; Fold-change: -2.31E-02; Z-score: -1.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.55E-02; Fold-change: 9.14E-02; Z-score: 1.92E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.25E-01; Fold-change: -1.58E-02; Z-score: -7.75E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.25E-10; Fold-change: 5.86E-01; Z-score: 1.21E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.95E-01; Fold-change: 1.35E-01; Z-score: 8.37E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.97E-01; Fold-change: -2.99E+00; Z-score: -1.07E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.98E-02; Fold-change: -1.88E+00; Z-score: -7.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.64E-01; Fold-change: 2.55E-01; Z-score: 9.03E-02
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.92E-01; Fold-change: -1.10E-01; Z-score: -4.72E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.91E-01; Fold-change: 6.52E-02; Z-score: 5.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.69E-01; Fold-change: -9.94E-03; Z-score: -5.91E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.40E-01; Fold-change: 3.36E-02; Z-score: 2.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.07E-01; Fold-change: 1.47E-02; Z-score: 1.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.67E-02; Fold-change: 6.74E-02; Z-score: 3.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.04E-01; Fold-change: 0.00E+00; Z-score: 0.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.27E-01; Fold-change: -1.77E-01; Z-score: -5.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.84E-01; Fold-change: 5.75E-02; Z-score: 2.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.66E-02; Fold-change: 8.71E-02; Z-score: 5.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.34E-01; Fold-change: 1.38E-01; Z-score: 4.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.36E-02; Fold-change: -1.16E-01; Z-score: -2.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.94E-01; Fold-change: 1.17E-03; Z-score: 9.12E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.75E-01; Fold-change: -6.76E-03; Z-score: -4.56E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.60E-01; Fold-change: -1.39E-02; Z-score: -1.95E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.06E-02; Fold-change: 2.54E-01; Z-score: 2.71E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.13E-01; Fold-change: -3.62E-02; Z-score: -4.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.43E-01; Fold-change: -6.95E-02; Z-score: -4.53E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.77E-01; Fold-change: 3.53E-02; Z-score: 6.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
2	Cytochrome P450-Catalyzed Metabolism of Cannabidiol to the Active Metabolite 7-Hydroxy-Cannabidiol Drug Metab Dispos. 2021 Oct;49(10):882-891. doi: 10.1124/dmd.120.000350.
3	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
4	Impact of polymorphisms in CYP and UGT enzymes and ABC and SLCO1B1 transporters on the pharmacokinetics and safety of desvenlafaxine
5	Pharmacokinetics and drug interactions of eslicarbazepine acetate Epilepsia. 2012 Jun;53(6):935-46. doi: 10.1111/j.1528-1167.2012.03519.x.
6	Clinical pharmacokinetics of losartan. Clin Pharmacokinet. 2005;44(8):797-814.
7	LABEL:ADICAVA- edaravone injection RADICAVA ORS- edaravone kit
8	Metabolism of megestrol acetate in vitro and the role of oxidative metabolites Xenobiotica. 2018 Oct;48(10):973-983. doi: 10.1080/00498254.2017.1386335.
9	Age-dependent hepatic UDP-glucuronosyltransferase gene expression and activity in children. Front Pharmacol. 2016 Nov 16;7:437.
10	UDP-glucuronosyltransferases (UGTs) 2B7 and UGT2B17 display converse specificity in testosterone and epitestosterone glucuronidation, whereas UGT2A1 conjugates both androgens similarly
11	Regioselective glucuronidation of denopamine: marked species differences and identification of human udp-glucuronosyltransferase isoform. Drug Metab Dispos. 2005 Mar;33(3):403-12.
12	Pharmacokinetic drug interactions of asciminib with the sensitive cytochrome P450 probe substrates midazolam, warfarin, and repaglinide in healthy participants
13	PharmGKB:Heroin
14	Clinical Investigation of Metabolic and Renal Clearance Pathways Contributing to the Elimination of Fevipiprant Using Probenecid as Perpetrator. Drug Metab Dispos. 2021 May;49(5):389-394. doi: 10.1124/dmd.120.000273.
15	DrugBank(Pharmacology-Metabolism):PT2977
16	Metabolic Profiling of the Novel Hypoxia-Inducible Factor 2 Inhibitor PT2385 In Vivo and In Vitro
17	UGT2B17 genetic polymorphisms dramatically affect the pharmacokinetics of MK-7246 in healthy subjects in a first-in-human study. Clin Pharmacol Ther. 2012 Jul;92(1):96-102.
18	Importance of UDP-glucuronosyltransferase 1A10 (UGT1A10) in the detoxification of polycyclic aromatic hydrocarbons: decreased glucuronidative activity of the UGT1A10139Lys isoform. Drug Metab Dispos. 2006 Jun;34(6):943-9.
19	Disposition of asciminib, a potent BCR-ABL1 tyrosine kinase inhibitor, in healthy male subjects
20	LC-MS/MS analysis of dextromethorphan metabolism in human saliva and urine to determine CYP2D6 phenotype and individual variability in N-demethylation and glucuronidation J Chromatogr B Analyt Technol Biomed Life Sci. 2004 Dec 25;813(1-2):217-25. doi: 10.1016/j.jchromb.2004.09.040.
21	Classics in Chemical Neuroscience: Dextromethorphan (DXM). ACS Chem Neurosci. 2023 Jun 21;14(12):2256-2270. doi: 10.1021/acschemneuro.3c00088.
22	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
23	Physiologically based pharmacokinetic (PBPK) modeling of the role of CYP2D6 polymorphism for metabolic phenotyping with dextromethorphan. Front Pharmacol. 2022 Oct 24;13:1029073. doi: 10.3389/fphar.2022.1029073.
24	Physiologically-based pharmacokinetic modeling of dextromethorphan to investigate interindividual variability within CYP2D6 activity score groups. CPT Pharmacometrics Syst Pharmacol. 2022 Apr;11(4):494-511. doi: 10.1002/psp4.12776.
25	Fevipiprant has a low risk of influencing co-medication pharmacokinetics: Impact on simvastatin and rosuvastatin in different SLCO1B1 genotypes
26	Metabolism of megestrol acetate in vitro and the role of oxidative metabolites. Xenobiotica. 2018 Oct;48(10):973-983.
27	DrugBank(Pharmacology-Metabolism):Osilodrostat
28	FDA label:Belzutifan
29	Stability studies of vorinostat and its two metabolites in human plasma, serum and urine
30	Uridine 5'-diphospho-glucuronosyltransferase genetic polymorphisms and response to cancer chemotherapy. Future Oncol. 2010 Apr;6(4):563-85.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.