Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0052)
DME Name	Aldehyde oxidase (AOX1), Homo sapiens
Synonyms	Azaheterocycle hydroxylase; Aldehyde oxidase 1; AO; AOX1
Gene Name	AOX1
UniProt ID	AOXA_HUMAN
Gene ID	316
EC Number	EC: 1.2.3.1 (Click to Show/Hide the Complete EC Tree) Oxidoreductase Aldehyde/oxo donor oxidoreductase Oxygen acceptor oxidoreductase EC: 1.2.3.1
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV HYPSLADKYESALEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLSDVNSFCFFTEAE KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGS RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESINLSAVG YFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSN TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFT KMIPRDEPGSYVPWNVPI
Structure	4UHW ; 4UHX ; 5EPG ; 6Q6Q
Pathway	Drug metabolism - cytochrome P450 (hsa00982 )
	Jak-STAT signaling pathway (hsa04630 )
	Metabolic pathways (hsa01100 )
	Nicotinate and nicotinamide metabolism (hsa00760 )
	Retinol metabolism (hsa00830 )
	Tryptophan metabolism (hsa00380 )
	Tyrosine metabolism (hsa00350 )
	Valine, leucine and isoleucine degradation (hsa00280 )
	Vitamin B6 metabolism (hsa00750 )
Function	This enzyme has broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. It plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. It also participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 9 Drugs
Idelalisib	Drug Info	Approved	Chronic lymphocytic leukaemia	ICD11: 2A82	[1], [2]
Capmatinib	Drug Info	Approved	Lung cancer	ICD11: 2C25	[3]
Lapatinib ditosylate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[4]
Lenvatinib mesylate	Drug Info	Approved	Thyroid cancer	ICD11: 2D10	[5]
Famciclovir	Drug Info	Approved	Genital herpes	ICD11: 1A94	[6]
Zaleplon	Drug Info	Approved	Insomnia	ICD11: 7A00	[7]
Pyrazinamide	Drug Info	Approved	Pulmonary tuberculosis	ICD11: 1B10	[8]
Valaciclovir	Drug Info	Approved	Virus infection	ICD11: 1A24-1D9Z	[9]
Valacyclovir Hydrochloride	Drug Info	Approved	Herpes simplex virus infection	ICD11: 1F00	[9]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
Nitrazepam	Drug Info	Phase 3	Insomnia	ICD11: 7A00	[10], [11]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 3 Drugs
N1-methylnicotinamide	Drug Info	Phase 2/3	Hypertriglyceridaemia	ICD11: 5C80	[12]
N-547	Drug Info	Phase 2/3	Lung cancer	ICD11: 2C25	[13]
XL-147	Drug Info	Phase 2	Uterine cancer	ICD11: 2C76	[7]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 3 Drugs
KW-2449	Drug Info	Phase 1	Acute myeloid leukaemia	ICD11: 2A60	[14]
SGX-523	Drug Info	Phase 1	Brain cancer	ICD11: 2A00	[15]
XK-469	Drug Info	Phase 1	Solid tumour/cancer	ICD11: 2A00-2F9Z	[7]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 3 Drugs
VUFB-11502	Drug Info	Preclinical	Amebiasis	ICD11: 1A36	[16]
Benzotetronic acid	Drug Info	Investigative	Discovery agent	ICD: N.A.	[17]
O-Benzylguanine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[18]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR009800	5-FP	5-Fluoruracil (5-FU)	Unclear - Unclear	5-FP	[19]
MR007664	Benzotetronic acid	2-Keto	Oxidation - Oxidationn	Benzotetronic acid	[17]
MR007667	Cis-Diol	2-Keto-ci8-dlol	Oxidation - Oxidationn	Benzotetronic acid	[17]
MR011083	Brimonidine	Brimonidine metabolite M2	Oxidation - Oxidation	Brimonidine	[20]
MR011085	Brimonidine	Brimonidine metabolite M3	Oxidation - Oxidation	Brimonidine	[20]
MR011084	Brimonidine metabolite M2	AGN 191858	Oxidation - Oxidation	Brimonidine	[20]
MR011086	Brimonidine metabolite M3	AGN 191858	Oxidation - Oxidation	Brimonidine	[20]
MR005464	Capmatinib	Capmatinib M16	Unclear - Unclear	Capmatinib	[3]
MR005466	Capmatinib	Capmatinib M19	Unclear - Unclear	Capmatinib	[3]
MR003086	6-deoxy penciclovir	Penciclovir	Oxidation - Oxidation	Famciclovir	[21]
MR007455	FYX-051	Unclear	Oxidation - 2-hydroxylation	FYX-051	[22]
MR012969	Idelalisib	GS-563117	Unclear - Unclear	Idelalisib	[1], [2]
MR008445	KW-2449	KW-2449 metabolite M1	Unclear - Unclear	KW-2449	[14]
MR001426	Lapatinib ditosylate metabolite M1	Lapatinib ditosylate metabolite M3	Oxidation - Oxidation	Lapatinib ditosylate	[4], [23], [4]
MR001442	Lenvatinib mesylate	.	Unclear - Unclear	Lenvatinib mesylate	[5]
MR006061	MNAM	Pyridone carboxamides	Oxidation - N-oxidation	N-547	[13]
MR010495	N1-methylnicotinamide	N1-methyl-2-pyridone-5- carboxamide (2py)	Unclear - Unclear	N1-methylnicotinamide	[12]
MR010496	N1-methylnicotinamide	N1-methyl-4-pyridone-3-carboxamide (4py)	Unclear - Unclear	N1-methylnicotinamide	[12]
MR002962	Nicotine imine	Cotinine	Unclear - Unclear	Nicotine	[24]
MR003792	Nitrazepam	7- AMlNO NlTRAZEPAM	Reduction - Reduction	Nitrazepam	[10], [11]
MR004429	6-O-benzyl-8-oxoguanine	8-oxoguanine	Oxidation - Debenzylation	O-Benzylguanine	[18]
MR004428	O-Benzylguanine	6-O-benzyl-8-oxoguanine	Oxidation - Oxidationn	O-Benzylguanine	[18]
MR002202	Pyrazinamide	5-hydroxypyrazinamide	Oxidation - Oxidation	Pyrazinamide	[8], [25], [26]
MR003976	SGX-523	2-quinolinone-SGX523	Unclear - Unclear	SGX-523	[15]
MR006778	4-Hydroxy tolbutamide	4-Carboxytolbutamide	Unclear - Unclear	Tolbutamide	[27]
MR005669	Vortioxetine Metabolite 1	LU-AA34443	Oxidation - Carboxylation	Vortioxetine hydrobromide	[28], [29]
MR007000	VUFB-11502	CYA-4-monoxide	Oxidation - Oxidationn	VUFB-11502	[16]
MR008450	XK-469	3-oxo- XK-469	Oxidation - Oxidation	XK-469	[7]
MR006070	XL-147	Unclear	Oxidation - Oxidationn	XL-147	[7], [30]
MR013291	Zaleplon	5-Oxo-zaleplon	Oxidation - Oxidationn	Zaleplon	[31], [32], [33]


⏷ Show the Full List of 30 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.17E-01; Fold-change: -6.17E-02; Z-score: -2.11E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.67E-01; Fold-change: 1.31E-01; Z-score: 7.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.92E-01; Fold-change: 1.30E-02; Z-score: 8.37E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.30E-02; Fold-change: 1.11E-03; Z-score: 6.49E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.94E-01; Fold-change: -7.72E-02; Z-score: -5.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.06E-01; Fold-change: 3.99E-02; Z-score: 3.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.09E-01; Fold-change: -1.86E-02; Z-score: -1.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.42E-09; Fold-change: 1.92E-01; Z-score: 3.79E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.34E-01; Fold-change: 5.21E-01; Z-score: 2.14E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.97E-01; Fold-change: -2.87E-01; Z-score: -1.06E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.83E-03; Fold-change: -8.49E-01; Z-score: -1.71E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-01; Fold-change: 4.23E-02; Z-score: 2.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.48E-02; Fold-change: 5.78E-02; Z-score: 3.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.39E-04; Fold-change: -4.10E-01; Z-score: -8.74E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.63E-03; Fold-change: 8.86E-01; Z-score: 4.21E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.03E-01; Fold-change: 1.03E-02; Z-score: 4.21E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-02; Fold-change: 2.16E-01; Z-score: 1.98E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.62E-03; Fold-change: -2.58E-01; Z-score: -1.62E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.42E-03; Fold-change: -1.59E-01; Z-score: -6.81E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.58E-02; Fold-change: -4.29E-01; Z-score: -5.47E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.86E-02; Fold-change: -1.24E-01; Z-score: -1.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.27E-03; Fold-change: -2.46E+00; Z-score: -3.54E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.39E-01; Fold-change: -6.69E-01; Z-score: -7.30E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.54E-02; Fold-change: -9.50E-02; Z-score: -2.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.94E-09; Fold-change: 2.10E-01; Z-score: 4.74E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.62E-04; Fold-change: -3.38E-01; Z-score: -6.15E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.58E-01; Fold-change: -8.65E-02; Z-score: -2.20E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.79E-02; Fold-change: 1.19E-01; Z-score: 6.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.48E-05; Fold-change: -2.15E+00; Z-score: -1.62E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.85E-09; Fold-change: -2.75E+00; Z-score: -1.55E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.84E-39; Fold-change: -1.49E+00; Z-score: -3.38E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.43E-25; Fold-change: -8.74E-01; Z-score: -1.36E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.80E-06; Fold-change: -1.48E+00; Z-score: -5.76E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-71; Fold-change: -1.88E+00; Z-score: -2.33E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.01E-58; Fold-change: -1.81E+00; Z-score: -2.86E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-03; Fold-change: -1.04E+00; Z-score: -1.15E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.27E-116; Fold-change: -2.61E+00; Z-score: -2.93E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.89E-71; Fold-change: -1.87E+00; Z-score: -2.16E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.86E-77; Fold-change: -1.74E+00; Z-score: -1.91E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.93E-13; Fold-change: -1.39E+00; Z-score: -1.57E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.36E-04; Fold-change: -2.80E+00; Z-score: -2.41E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.14E-05; Fold-change: -3.70E+00; Z-score: -2.18E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.26E-01; Fold-change: -2.24E-01; Z-score: -5.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.65E-04; Fold-change: -1.60E-01; Z-score: -1.46E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.69E-04; Fold-change: -2.15E+00; Z-score: -4.34E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.08E-13; Fold-change: -2.15E+00; Z-score: -2.74E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.73E-02; Fold-change: -2.21E+00; Z-score: -1.10E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.63E-27; Fold-change: -2.76E+00; Z-score: -2.39E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.94E-01; Fold-change: -8.83E-02; Z-score: -4.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.14E-03; Fold-change: -1.77E+00; Z-score: -1.97E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.56E-05; Fold-change: -3.24E-01; Z-score: -1.96E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.88E-70; Fold-change: -2.51E+00; Z-score: -3.80E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.11E-26; Fold-change: -2.67E+00; Z-score: -3.61E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 2.40E-18; Fold-change: -1.11E+00; Z-score: -5.35E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.07E-02; Fold-change: -5.24E-01; Z-score: -1.10E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.76E-03; Fold-change: -8.25E-01; Z-score: -1.38E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.52E-01; Fold-change: -6.20E-02; Z-score: -6.81E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.95E-01; Fold-change: 1.99E-01; Z-score: 7.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.82E-03; Fold-change: -4.94E-01; Z-score: -1.42E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.44E-01; Fold-change: 2.69E-02; Z-score: 1.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.05E-01; Fold-change: 1.88E-01; Z-score: 4.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.98E-01; Fold-change: 5.93E-02; Z-score: 5.58E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.12E-01; Fold-change: -6.02E-02; Z-score: -1.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.02E-01; Fold-change: 8.91E-02; Z-score: 7.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.14E-02; Fold-change: 4.96E-01; Z-score: 1.86E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.26E-01; Fold-change: 1.52E-02; Z-score: 6.50E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.43E-01; Fold-change: 4.42E-02; Z-score: 3.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.60E-01; Fold-change: 2.08E-01; Z-score: 1.90E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.56E-02; Fold-change: -5.97E-01; Z-score: -1.19E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.41E-01; Fold-change: -1.75E-01; Z-score: -8.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.10E-01; Fold-change: 1.92E-03; Z-score: 1.27E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.78E-02; Fold-change: -3.62E-01; Z-score: -6.02E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.08E-01; Fold-change: 4.62E-03; Z-score: 3.96E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.24E-01; Fold-change: 1.07E-01; Z-score: 7.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.96E-04; Fold-change: -9.67E-02; Z-score: -5.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.83E-01; Fold-change: -3.48E-02; Z-score: -2.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.10E-01; Fold-change: -2.23E-02; Z-score: -6.66E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.81E-01; Fold-change: 5.24E-03; Z-score: 4.93E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.48E-01; Fold-change: 3.78E-03; Z-score: 1.77E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.91E-01; Fold-change: 9.86E-02; Z-score: 3.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.07E-01; Fold-change: 1.04E-01; Z-score: 5.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.79E-01; Fold-change: 1.55E-03; Z-score: 1.27E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.18E-01; Fold-change: -3.33E-03; Z-score: -3.12E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.82E-01; Fold-change: -1.51E-02; Z-score: -3.80E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.56E-01; Fold-change: -6.28E-02; Z-score: -1.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.80E-01; Fold-change: 1.24E-01; Z-score: 6.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.46E-01; Fold-change: -1.87E-02; Z-score: -1.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 5.12E-01; Fold-change: -4.51E-02; Z-score: -2.96E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.45E-01; Fold-change: -8.49E-03; Z-score: -5.32E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.95E-02; Fold-change: -7.41E-01; Z-score: -1.39E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.57E-04; Fold-change: 1.31E-01; Z-score: 1.01E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.44E-02; Fold-change: 5.71E-02; Z-score: 4.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.11E-01; Fold-change: -3.05E-01; Z-score: -3.93E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.61E-01; Fold-change: -8.32E-02; Z-score: -3.92E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.11E-01; Fold-change: 1.42E-01; Z-score: 2.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.96E-01; Fold-change: 4.51E-02; Z-score: 5.45E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.56E-01; Fold-change: -8.84E-02; Z-score: -4.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.58E-01; Fold-change: 9.32E-02; Z-score: 1.84E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.64E-01; Fold-change: -1.40E-01; Z-score: -4.76E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.34E-02; Fold-change: -9.47E-01; Z-score: -1.24E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.58E-02; Fold-change: 1.54E-01; Z-score: 2.47E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.71E-02; Fold-change: 2.06E-01; Z-score: 1.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.28E-01; Fold-change: -1.22E-01; Z-score: -1.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.44E-01; Fold-change: -1.93E-01; Z-score: -2.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.01E-02; Fold-change: -8.05E-02; Z-score: -3.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.72E-02; Fold-change: 2.14E-02; Z-score: 7.87E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.58E-05; Fold-change: -1.53E+00; Z-score: -4.55E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.27E-01; Fold-change: -9.81E-02; Z-score: -3.47E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.05E-01; Fold-change: -5.83E-01; Z-score: -1.25E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.71E-01; Fold-change: 1.67E-01; Z-score: 6.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.53E-04; Fold-change: -4.30E+00; Z-score: -1.61E+01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.06E-01; Fold-change: -1.65E-02; Z-score: -5.55E-02
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.76E-01; Fold-change: -2.00E-02; Z-score: -7.09E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.94E-07; Fold-change: -7.27E-01; Z-score: -5.09E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.60E-13; Fold-change: -6.90E-01; Z-score: -9.59E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.90E-04; Fold-change: 2.99E-01; Z-score: 4.95E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.90E-01; Fold-change: 4.88E-01; Z-score: 6.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.60E-04; Fold-change: 2.30E-01; Z-score: 5.58E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.29E-01; Fold-change: 1.64E-03; Z-score: 4.76E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.19E-01; Fold-change: 5.10E-02; Z-score: 4.76E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.95E-02; Fold-change: 2.13E-01; Z-score: 3.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.20E-01; Fold-change: 4.15E-02; Z-score: 2.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.42E-03; Fold-change: 7.42E-01; Z-score: 1.15E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.05E-02; Fold-change: 1.17E-01; Z-score: 5.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.96E-01; Fold-change: 1.43E-02; Z-score: 6.11E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.63E-01; Fold-change: -1.59E-01; Z-score: -4.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.97E-05; Fold-change: 2.68E+00; Z-score: 2.06E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.20E-01; Fold-change: -2.29E-01; Z-score: -3.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.74E-01; Fold-change: 3.90E-01; Z-score: 3.70E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.09E-01; Fold-change: 9.65E-02; Z-score: 1.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.77E-01; Fold-change: -4.44E-02; Z-score: -4.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Clinical drug interaction profile of idelalisib in healthy subjects
2	Identification of Novel Pathways in Idelalisib Metabolism and Bioactivation
3	Absorption, Distribution, Metabolism, and Excretion of Capmatinib (INC280) in Healthy Male Volunteers and In Vitro Aldehyde Oxidase Phenotyping of the Major Metabolite
4	Detoxication versus Bioactivation Pathways of Lapatinib In Vitro: UGT1A1 Catalyzes the Hepatic Glucuronidation of Debenzylated Lapatinib Drug Metab Dispos. 2021 Mar;49(3):233-244. doi: 10.1124/dmd.120.000236.
5	LABEL:LENVIMA- lenvatinib capsule
6	Pharmacokinetic modeling of penciclovir and BRL42359 in the plasma and tears of healthy cats to optimize dosage recommendations for oral administration of famciclovir Am J Vet Res. 2016 Aug;77(8):833-45. doi: 10.2460/ajvr.77.8.833.
7	Characterization of aldehyde oxidase enzyme activity in cryopreserved human hepatocytes. Drug Metab Dispos. 2012 Feb;40(2):267-75.
8	Factors Affecting the Pharmacokinetics of Pyrazinamide and Its Metabolites in Patients Coinfected with HIV and Implications for Individualized Dosing Antimicrob Agents Chemother. 2021 Jun 17;65(7):e0004621. doi: 10.1128/AAC.00046-21.
9	Absolute bioavailability and metabolic disposition of valaciclovir, the L-valyl ester of acyclovir, following oral administration to humans
10	Production of superoxide during the metabolism of nitrazepam
11	Identification of enzymes responsible for nitrazepam metabolism and toxicity in human
12	N1-Methylnicotinamide: An Anti-Ovarian Aging Hormetin?
13	CYP-eicosanoids--a new link between omega-3 fatty acids and cardiac disease? Prostaglandins Other Lipid Mediat. 2011 Nov;96(1-4):99-108.
14	Monoamine oxidase B oxidizes a novel multikinase inhibitor KW-2449 to its iminium ion and aldehyde oxidase further converts it to the oxo-piperazine form in human
15	Species-specific metabolism of SGX523 by aldehyde oxidase and the toxicological implications. Drug Metab Dispos. 2010 Aug;38(8):1277-85.
16	The critical role of oxidative stress in the toxicity and metabolism of quinoxaline 1,4-di-N-oxides in vitro and in vivo. Drug Metab Rev. 2016 May;48(2):159-82.
17	Stereoselective pharmacokinetics of RS-8359, a selective and reversible MAO-A inhibitor, by species-dependent drug-metabolizing enzymes. Chirality. 2005 Mar;17(3):135-41.
18	Role of cytochrome P450 isoenzymes in metabolism of O(6)-benzylguanine: implications for dacarbazine activation. Clin Cancer Res. 2001 Dec;7(12):4239-44.
19	Phase I clinical trial of 5-fluoro-pyrimidinone (5FP), an oral prodrug of 5-fluorouracil (5FU)
20	Characterization of brimonidine metabolism with rat, rabbit, dog, monkey and human liver fractions and rabbit liver aldehyde oxidase
21	Evidence that famciclovir (BRL 42810) and its associated metabolites do not inhibit the 6 beta-hydroxylation of testosterone in human liver microsomes. Drug Metab Dispos. 1993 Jan-Feb;21(1):18-23.
22	FYX-051: a novel and potent hybrid-type inhibitor of xanthine oxidoreductase
23	Case Study 11: Considerations for Enzyme Mapping Experiments-Interaction Between the Aldehyde Oxidase Inhibitor Hydralazine and Glutathione. Methods Mol Biol. 2021;2342:809-823. doi: 10.1007/978-1-0716-1554-6_30.
24	DrugBank(Pharmacology-Metabolism)Nicotine
25	Metabolism and Hepatotoxicity of Pyrazinamide, an Antituberculosis Drug Drug Metab Dispos. 2021 Aug;49(8):679-682. doi: 10.1124/dmd.121.000389.
26	Determination of pyrazinamide and its main metabolites in rat urine by high-performance liquid chromatography J Chromatogr B Biomed Sci Appl. 1997 Aug 1;695(2):365-72. doi: 10.1016/s0378-4347(97)00175-8.
27	Methyl-hydroxylation and subsequent oxidation to produce carboxylic acid is the major metabolic pathway of tolbutamide in chimeric TK-NOG mice transplanted with human hepatocytes
28	Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
29	Vortioxetine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2018 Jun;57(6):673-686.
30	Aldehyde oxidase and its role as a drug metabolizing enzyme
31	Variability of Zaleplon 5-Oxidase Activity in Mice and Humans, and Inhibition by Raloxifene
32	Metabolism of zaleplon by human liver: evidence for involvement of aldehyde oxidase. Xenobiotica. 2002 Oct;32(10):835-47.
33	Separation and identification of zaleplon metabolites in human urine using capillary electrophoresis with laser-induced fluorescence detection and liquid chromatography-mass spectrometry

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.