Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0047)
DME Name	UDP-glucuronosyltransferase 2B4 (UGT2B4), Homo sapiens
Synonyms	UDP-glucuronosyltransferase family 2 member B4; Hyodeoxycholic acid-specific UDPGT; UDPGT 2B4; UDPGTh-1; UGT2B4
Gene Name	UGT2B4
UniProt ID	UD2B4_HUMAN
Gene ID	7363
EC Number	EC: 2.4.1.17 (Click to Show/Hide the Complete EC Tree) Transferase Glycosyltransferases Hexosyltransferase EC: 2.4.1.17
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA SISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFN DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA HDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD
Pathway	Ascorbate and aldarate metabolism (hsa00053 )
	Bile secretion (hsa04976 )
	Chemical carcinogenesis (hsa05204 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Drug metabolism - other enzymes (hsa00983 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Pentose and glucuronate interconversions (hsa00040 )
	Porphyrin and chlorophyll metabolism (hsa00860 )
	Retinol metabolism (hsa00830 )
	Steroid hormone biosynthesis (hsa00140 )
Function	This enzyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics (such as 4-methylumbelliferone, 1-naphthol, 4-nitrophenol, 2-aminophenol, 4-hydroxybiphenyl and menthol). It is also capable of 6 alpha- hydroxyglucuronidation of hyodeoxycholic acid.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 18 Drugs
Bupropion	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[1]
Diclofenac sodium	Drug Info	Approved	Osteoarthritis	ICD11: FA00	[2]
Labetalol	Drug Info	Approved	Essential hypertension	ICD11: BA00	[3]
Carvedilol	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[4]
Dextromethorphan hydrobromide	Drug Info	Approved	Atherosclerosis	ICD11: BA80	[5]
Belinostat	Drug Info	Approved	Anaplastic large cell lymphoma	ICD11: 2A90	[6], [7]
Cenobamate	Drug Info	Approved	Focal seizure	ICD11: 8A68	[8]
Cenobamate	Drug Info	Approved	Focal seizure	ICD11: 8A68	[9]
Codeine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[10]
Desvenlafaxine	Drug Info	Approved	Major depressive disorder	ICD11: 6A70-6A7Z	[11]
Eslicarbazepine acetate	Drug Info	Approved	Epilepsy	ICD11: 8A60	[12]
Ibuprofen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[13], [14]
Midazolam hydrochloride	Drug Info	Approved	Anxiety disorder	ICD11: 6B00	[15], [16], [17]
Morphine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[13], [18], [19]
Sarpogrelate	Drug Info	Approved	Diabetic complication	ICD11: 5A2Y	[20]
Clofazimine	Drug Info	Approved	Crohn disease	ICD11: DD70	[21]
Canagliflozin	Drug Info	Approved	Diabetes mellitus	ICD11: 5A10	[22]
Flurbiprofen sodium	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[23]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
Dihydrocodeine	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[24]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
Heroin	Drug Info	Phase 3	Opiate dependence	ICD11: 6C43	[25]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 2 Drugs
LIK-066	Drug Info	Phase 2	Heart failure	ICD11: BD10-BD1Z	[26]
PT2385	Drug Info	Phase 2	Von hippel-lindau disease	ICD11: 5A75	[27]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
DA-1229	Drug Info	Phase 1	Type-2 diabetes	ICD11: 5A11	[28]
Experimental Enzyme Kinetic Data of Drugs			Click to Show/Hide the Full List of Drugs: 1 Drugs
Labetalol	Drug Info	Approved	Essential hypertension	Km = 0.368 microM	[3]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR000496	R,R-hydroxybupropion	R,R-hydroxybupropion glucuronide	Conjugation - Glucuronidation	Bupropion	[1]
MR000508	S,S-threohydrobupropion	S,S-threohydrobupropion glucuronide	Conjugation - Glucuronidation	Bupropion	[1]
MR000548	Canagliflozin	Canagliflozin metabolite M7	Conjugation - O-Glucuronidation	Canagliflozin	[29]
MR000549	Canagliflozin	Canagliflozin metabolite M5	Conjugation - O-Glucuronidation	Canagliflozin	[29]
MR000574	Carvedilol	Carvedilol glucuronide	Conjugation - O-Glucuronidation	Carvedilol	[4]
MR000596	Cenobamate	Cenobamate metabolite M1	Conjugation - Glucuronidation	Cenobamate	[8]
MR000597	Cenobamate	Cenobamate metabolite M11	Conjugation - Glucuronidation	Cenobamate	[8]
MR000598	Cenobamate	Cenobamate metabolite M3	Conjugation - Glucuronidation	Cenobamate	[8]
MR000599	Cenobamate	Cenobamate metabolite M2a/2b	Conjugation - Glucuronidation	Cenobamate	[8]
MR006560	Hydrolytic-deaminated clofazimine	Hydrolytic-deaminated clofazimine glucuronide	Conjugation - Glucuronidation	Clofazimine	[21]
MR004099	Morphine	Normorphine	Conjugation - Glucuronidation	Codeine	[30]
MR008452	4S-Hydroxyevogliptin	4S-Hydroxyevogliptin glucuronide	Conjugation - Glucuronidation	DA-1229	[28]
MR000815	3-hydroxymorphinan	3-hydroxymorphinan O-glucuronide	Conjugation - Glucuronidation	Dextromethorphan hydrobromide	[31], [32]
MR000815	3-hydroxymorphinan	3-hydroxymorphinan O-glucuronide	Conjugation - Glucuronidation	Dextromethorphan hydrobromide	[14], [32]
MR000813	Dextrorphan	Dextrorphan O-glucuronide	Conjugation - Glucuronidation	Dextromethorphan hydrobromide	[31], [33], [34]
MR002618	Diclofenac sodium	Diclofenac acyl glucuronide	Conjugation - Glucuronidation	Diclofenac sodium	[2]
MR007117	Dihydrocodeine	Dihydrocodeine-6-glucuronide	Conjugation - Glucuronidation	Dihydrocodeine	[35], [24]
MR005044	Flurbiprofen sodium	Flurbiprofen glucuronide	Conjugation - Glucuronidation	Flurbiprofen sodium	[23]
MR001125	Gemfibrozil	Gemfibrozil 1-beta-glucuronide metabolite	Conjugation - O-Glucuronidation	Gemfibrozil	[36], [14], [37]
MR005979	GV-150526	Gavestinel acyl glucuronid	Conjugation - Glucuronidation	GV-150526	[14]
MR013333	Morphine	Morphine-3-glucuronide	Conjugation - Glucuronidation	Heroin	[25]
MR013332	Morphine	Morphine-6-glucuronide	Conjugation - Glucuronidation	Heroin	[25]
MR004643	Ibuprofen	Ibuprofen glucuronide	Conjugation - O-glucuronidation	Ibuprofen	[13], [14]
MR012315	LIK-066	LIK-066 M17,27	Multi-steps Reaction - Oxidation; direct glucuronidation	LIK-066	[26]
MR004745	Midazolam hydrochloride	1-hydroxymidazolam glucuronide	Conjugation - N-glucuronidation	Midazolam hydrochloride	[15], [16], [17]
MR004804	Morphine	Morphine glucuronide	Conjugation - Glucuronidation	Morphine	[13], [18], [19]
MR013643	PT2385 M7	PT2385 M12	Multi-steps Reaction - Oxidative Defluorination; Glucuronide conjugation	PT2385	[27]
MR008973	Sarpogrelate metabolite M-1	SMG3	Conjugation - Glucuronidation	Sarpogrelate	[20]


⏷ Show the Full List of 28 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.37E-01; Fold-change: -1.47E-02; Z-score: -1.92E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.64E-01; Fold-change: 5.06E-02; Z-score: 5.53E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.59E-01; Fold-change: -2.23E-02; Z-score: -1.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-02; Fold-change: -1.35E-02; Z-score: -9.85E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.18E-01; Fold-change: 2.96E-02; Z-score: 4.36E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.73E-01; Fold-change: 1.69E-02; Z-score: 1.86E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.37E-02; Fold-change: -2.54E-02; Z-score: -2.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.09E-01; Fold-change: -5.14E-03; Z-score: -4.90E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.96E-01; Fold-change: -9.24E-03; Z-score: -1.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.88E-02; Fold-change: -5.04E-02; Z-score: -3.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.74E-03; Fold-change: 5.17E-02; Z-score: 8.27E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.91E-01; Fold-change: 1.10E-02; Z-score: 9.79E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.49E-01; Fold-change: -8.41E-03; Z-score: -7.48E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.47E-01; Fold-change: 1.01E-02; Z-score: 1.30E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.86E-01; Fold-change: 2.97E-02; Z-score: 2.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.98E-02; Fold-change: 1.02E-01; Z-score: 9.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.74E-01; Fold-change: -5.37E-02; Z-score: -6.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.19E-01; Fold-change: -7.10E-02; Z-score: -7.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.36E-01; Fold-change: -5.22E-03; Z-score: -6.03E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.79E-01; Fold-change: 2.18E-02; Z-score: 1.97E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.47E-03; Fold-change: 6.01E-02; Z-score: 4.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.89E-02; Fold-change: 4.83E-02; Z-score: 4.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.79E-01; Fold-change: 1.93E-02; Z-score: 1.09E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.73E-02; Fold-change: -4.80E-02; Z-score: -3.27E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.63E-13; Fold-change: 5.28E-02; Z-score: 4.44E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.34E-09; Fold-change: -6.69E-03; Z-score: -5.84E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.29E-01; Fold-change: -1.60E-01; Z-score: -1.02E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.38E-01; Fold-change: 1.30E-02; Z-score: 9.88E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.76E-03; Fold-change: -1.17E-02; Z-score: -1.29E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.51E-02; Fold-change: -9.58E-03; Z-score: -2.11E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.09E-14; Fold-change: -2.71E-01; Z-score: -9.40E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.45E-14; Fold-change: -2.21E-01; Z-score: -6.78E-01
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.33E-01; Fold-change: 1.25E-01; Z-score: 2.27E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.86E-07; Fold-change: -3.97E-01; Z-score: -6.84E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.20E-08; Fold-change: -4.51E-01; Z-score: -7.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.96E-03; Fold-change: -1.29E-01; Z-score: -5.22E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.58E-01; Fold-change: 2.22E-02; Z-score: 1.64E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.91E-01; Fold-change: -7.71E-03; Z-score: -3.54E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.43E-01; Fold-change: -1.07E-01; Z-score: -1.52E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.80E-01; Fold-change: 1.11E-02; Z-score: 1.92E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.03E-01; Fold-change: -1.93E-02; Z-score: -1.56E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.47E-03; Fold-change: 1.42E-02; Z-score: 1.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.25E-01; Fold-change: -2.49E-02; Z-score: -2.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.37E-04; Fold-change: 1.01E-02; Z-score: 1.07E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.38E-01; Fold-change: 7.30E-03; Z-score: 6.39E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.10E-11; Fold-change: 5.15E-01; Z-score: 1.23E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.54E-01; Fold-change: -3.06E-02; Z-score: -2.10E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.86E-01; Fold-change: 6.88E-04; Z-score: 2.82E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.30E-01; Fold-change: 6.74E-03; Z-score: 6.54E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.08E-01; Fold-change: 2.26E-02; Z-score: 8.35E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.23E-01; Fold-change: 2.65E-02; Z-score: 4.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.43E-01; Fold-change: 2.97E-03; Z-score: 2.28E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.06E-03; Fold-change: 5.76E-02; Z-score: 4.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 3.31E-02; Fold-change: 1.29E-02; Z-score: 2.50E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.49E-01; Fold-change: 1.30E-02; Z-score: 9.27E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.89E-01; Fold-change: 9.26E-03; Z-score: 6.23E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.03E-06; Fold-change: -5.33E-02; Z-score: -3.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.04E-01; Fold-change: 4.55E-02; Z-score: 6.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.01E-01; Fold-change: 3.11E-04; Z-score: 4.55E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.79E-01; Fold-change: -4.67E-03; Z-score: -4.40E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.87E-01; Fold-change: -9.13E-02; Z-score: -5.44E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.22E-01; Fold-change: 5.80E-02; Z-score: 9.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.46E-01; Fold-change: 2.15E-02; Z-score: 1.54E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.36E-01; Fold-change: 2.65E-02; Z-score: 2.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.81E-01; Fold-change: -1.21E-02; Z-score: -1.23E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.00E-01; Fold-change: -4.14E-02; Z-score: -4.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.36E-01; Fold-change: -8.89E-03; Z-score: -5.18E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.08E-01; Fold-change: 9.86E-03; Z-score: 9.14E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.36E-01; Fold-change: -2.09E-01; Z-score: -4.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.97E-01; Fold-change: 1.44E-01; Z-score: 5.02E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.71E-01; Fold-change: -4.08E-02; Z-score: -6.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.45E-01; Fold-change: 2.35E-02; Z-score: 2.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.28E-01; Fold-change: 5.47E-02; Z-score: 7.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.04E-01; Fold-change: 6.49E-02; Z-score: 1.02E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.79E-01; Fold-change: -5.37E-03; Z-score: -6.34E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.78E-02; Fold-change: -1.77E-02; Z-score: -1.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.54E-01; Fold-change: 2.38E-02; Z-score: 2.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.36E-01; Fold-change: 3.04E-03; Z-score: 4.51E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.70E-01; Fold-change: -1.04E-03; Z-score: -9.68E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.68E-01; Fold-change: 6.01E-03; Z-score: 2.84E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.18E-01; Fold-change: -1.35E-02; Z-score: -1.36E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.17E-01; Fold-change: -2.88E-02; Z-score: -3.38E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.49E-01; Fold-change: -2.11E-02; Z-score: -2.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.49E-01; Fold-change: 1.30E-02; Z-score: 1.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.54E-01; Fold-change: 7.87E-03; Z-score: 7.74E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.26E-01; Fold-change: 9.58E-02; Z-score: 7.40E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.46E-01; Fold-change: -9.85E-02; Z-score: -1.04E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 9.39E-01; Fold-change: 1.13E-01; Z-score: 1.90E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.75E-01; Fold-change: 3.87E-02; Z-score: 4.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.74E-01; Fold-change: 0.00E+00; Z-score: 0.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.78E-06; Fold-change: 1.86E-01; Z-score: 1.63E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.73E-01; Fold-change: 1.57E-02; Z-score: 1.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.17E-01; Fold-change: -3.88E-02; Z-score: -8.93E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.50E-01; Fold-change: 6.04E-02; Z-score: 3.96E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.30E-02; Fold-change: 8.16E-02; Z-score: 1.05E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.35E-01; Fold-change: 1.14E-02; Z-score: 1.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.87E-01; Fold-change: -1.60E-01; Z-score: -1.54E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.92E-01; Fold-change: 4.91E-03; Z-score: 2.30E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.89E-01; Fold-change: -1.26E-01; Z-score: -4.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.04E-01; Fold-change: 2.76E-02; Z-score: 9.14E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.88E-01; Fold-change: 2.28E-03; Z-score: 2.93E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.62E-01; Fold-change: -2.74E-02; Z-score: -7.44E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.36E-01; Fold-change: -2.64E-02; Z-score: -3.53E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.69E-01; Fold-change: -4.59E-02; Z-score: -1.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-01; Fold-change: -2.12E-02; Z-score: -1.92E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.33E-01; Fold-change: 4.10E-02; Z-score: 1.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.45E-01; Fold-change: -1.44E-02; Z-score: -2.51E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.94E-01; Fold-change: -2.21E-02; Z-score: -3.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.34E-01; Fold-change: 1.20E-01; Z-score: 4.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.39E-01; Fold-change: 1.56E-01; Z-score: 3.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.78E-02; Fold-change: -3.43E+00; Z-score: -1.06E+01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.39E-01; Fold-change: -3.16E-03; Z-score: -2.59E-02
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.61E-01; Fold-change: -7.94E-03; Z-score: -3.62E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.93E-01; Fold-change: 4.36E-03; Z-score: 5.87E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.01E-03; Fold-change: -4.33E-02; Z-score: -3.79E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.99E-03; Fold-change: -2.33E-02; Z-score: -8.81E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.41E-01; Fold-change: -1.59E-02; Z-score: -3.07E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.51E-01; Fold-change: 4.32E-02; Z-score: 9.24E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.94E-01; Fold-change: -2.90E-02; Z-score: -1.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.30E-01; Fold-change: 0.00E+00; Z-score: 0.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.05E-01; Fold-change: -4.86E-02; Z-score: -6.69E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.54E-01; Fold-change: -1.98E-02; Z-score: -3.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.55E-02; Fold-change: -1.34E-01; Z-score: -1.04E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.89E-01; Fold-change: 1.21E-02; Z-score: 6.13E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-01; Fold-change: 8.53E-02; Z-score: 8.81E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.85E-01; Fold-change: 0.00E+00; Z-score: 0.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.75E-01; Fold-change: -5.52E-03; Z-score: -5.49E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.76E-01; Fold-change: 1.43E-03; Z-score: 1.93E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.08E-01; Fold-change: -1.78E-02; Z-score: -1.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.03E-01; Fold-change: 5.12E-03; Z-score: 2.54E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.78E-01; Fold-change: -2.10E-02; Z-score: -8.09E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	DrugBank(Pharmacology-Metabolism)Bupropion
2	DrugBank(Pharmacology-Metabolism)Diclofenac sodium
3	Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
4	Metabolism of carvedilol in dogs, rats, and mice Drug Metab Dispos. 1998 Oct;26(10):958-69.
5	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
6	Glucuronidation by UGT1A1 is the dominant pathway of the metabolic disposition of belinostat in liver cancer patients. PLoS One. 2013;8(1):e54522.
7	In vitro characterization of belinostat glucuronidation: demonstration of both UGT1A1 and UGT2B7 as the main contributing isozymes
8	Mass Balance, Metabolism, and Excretion of Cenobamate, a New Antiepileptic Drug, After a Single Oral Administration in Healthy Male Subjects Eur J Drug Metab Pharmacokinet. 2020 Aug;45(4):513-522. doi: 10.1007/s13318-020-00615-7.
9	DrugBank(Pharmacology-Metabolism):Cenobamate
10	Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects. Br J Clin Pharmacol. 2012 May;73(5):786-94.
11	Impact of polymorphisms in CYP and UGT enzymes and ABC and SLCO1B1 transporters on the pharmacokinetics and safety of desvenlafaxine
12	Pharmacokinetics and drug interactions of eslicarbazepine acetate Epilepsia. 2012 Jun;53(6):935-46. doi: 10.1111/j.1528-1167.2012.03519.x.
13	Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
14	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
15	The inhibition study of human UDP-glucuronosyltransferases with cytochrome P450 selective substrates and inhibitors
16	Contribution of the N-glucuronidation pathway to the overall in vitro metabolic clearance of midazolam in humans
17	The Oral Bioavailability and Metabolism of Midazolam in Stable Critically Ill Children: A Pharmacokinetic Microtracing Study
18	Metabolism and pharmacokinetics of morphine in neonates: A review
19	Morphine metabolism, transport and brain disposition
20	Glucuronidation of a sarpogrelate active metabolite is mediated by UDP-glucuronosyltransferases 1A4, 1A9, and 2B4
21	Characterization of Clofazimine Metabolism in Human Liver Microsomal Incubation In Vitro
22	Effects of rifampin, cyclosporine A, and probenecid on the pharmacokinetic profile of canagliflozin, a sodium glucose co-transporter 2 inhibitor, in healthy participants. Int J Clin Pharmacol Ther. 2015 Feb;53(2):115-28.
23	DrugBank(Pharmacology-Metabolism):Flurbiprofen
24	Adult and infant pharmacokinetic profiling of dihydrocodeine using physiologically based pharmacokinetic modeling. Biopharm Drug Dispos. 2019 Nov;40(9):350-357.
25	PharmGKB:Heroin
26	Pharmacokinetics, metabolism, and excretion of licogliflozin, a dual inhibitor of SGLT1/2, in rats, dogs, and humans
27	Metabolic Profiling of the Novel Hypoxia-Inducible Factor 2 Inhibitor PT2385 In Vivo and In Vitro
28	In Vitro Metabolic Pathways of the New Anti-Diabetic Drug Evogliptin in Human Liver Preparations
29	Clinical Pharmacokinetic, Pharmacodynamic, and Drug-Drug Interaction Profile of Canagliflozin, a Sodium-Glucose Co-transporter 2 Inhibitor Clin Pharmacokinet. 2015 Oct;54(10):1027-41. doi: 10.1007/s40262-015-0285-z.
30	Diclofenac does not interact with codeine metabolism in vivo: a study in healthy volunteers
31	LC-MS/MS analysis of dextromethorphan metabolism in human saliva and urine to determine CYP2D6 phenotype and individual variability in N-demethylation and glucuronidation J Chromatogr B Analyt Technol Biomed Life Sci. 2004 Dec 25;813(1-2):217-25. doi: 10.1016/j.jchromb.2004.09.040.
32	Classics in Chemical Neuroscience: Dextromethorphan (DXM). ACS Chem Neurosci. 2023 Jun 21;14(12):2256-2270. doi: 10.1021/acschemneuro.3c00088.
33	Physiologically based pharmacokinetic (PBPK) modeling of the role of CYP2D6 polymorphism for metabolic phenotyping with dextromethorphan. Front Pharmacol. 2022 Oct 24;13:1029073. doi: 10.3389/fphar.2022.1029073.
34	Physiologically-based pharmacokinetic modeling of dextromethorphan to investigate interindividual variability within CYP2D6 activity score groups. CPT Pharmacometrics Syst Pharmacol. 2022 Apr;11(4):494-511. doi: 10.1002/psp4.12776.
35	Pharmacokinetics of dihydrocodeine and its active metabolite after single and multiple oral dosing. Br J Clin Pharmacol. 1999 Sep;48(3):317-22.
36	Intracellular pharmacokinetics of gemcitabine, its deaminated metabolite 2',2'-difluorodeoxyuridine and their nucleotides Br J Clin Pharmacol. 2018 Jun;84(6):1279-1289. doi: 10.1111/bcp.13557.
37	The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver. Drug Metab Dispos. 2007 Nov;35(11):2040-4.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.