Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0008)
DME Name	Sulfotransferase 1A1 (SULT1A1), Homo sapiens
Synonyms	Sulfotransferase family cytosolic 1A member 1; Aryl sulfotransferase 1A1; Aryl sulfotransferase 1; Thermostable phenol sulfotransferase; Phenol sulfotransferase 1; Phenol-sulfating phenol sulfotransferase 1; Ts-PST; HAST1/HAST2; OK/SW-cl.88; P-PST 1; ST1A1; STP; STP1; SULT1A1
Gene Name	SULT1A1
UniProt ID	ST1A1_HUMAN
Gene ID	6817
EC Number	EC: 2.8.2.1 (Click to Show/Hide the Complete EC Tree) Transferase Sulfotransferase Sulfotransferase EC: 2.8.2.1
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Structure	2D06 ; 3QVU ; 3QVV ; 3U3J ; 3U3K ; 3U3M ; 3U3O ; 3U3R ; 4GRA
Pathway	Chemical carcinogenesis (hsa05204 )
Function	This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. It also has estrogen sulfotransferase activity and is responsible for the sulfonation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 26 Drugs
Tamoxifen citrate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[1]
Warfarin sodium	Drug Info	Approved	Atrial fibrillation	ICD11: BC81	[2]
Progesterone	Drug Info	Approved	Premature labour	ICD11: JB00	[3]
Levodopa	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[4]
Apomorphine	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[5]
Digitoxin	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[6]
Minoxidil	Drug Info	Approved	Essential hypertension	ICD11: BA00	[7]
Naproxen	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[8]
Rotigotine	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[9]
Tapentadol	Drug Info	Approved	Neuropathic pain	ICD11: 8E43	[10]
Adenosine	Drug Info	Approved	Atrial fibrillation	ICD11: BC81	[11]
Aspirin	Drug Info	Approved	Myocardial infarction	ICD11: BA41	[12]
Budesonide	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[13]
Epinephrine hydrochloride	Drug Info	Approved	Allergy	ICD11: 4A80	[14]
Liothyronine	Drug Info	Approved	Hypothyroidism	ICD11: 5A00	[15]
Acetaminophen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[16]
Apixaban	Drug Info	Approved	Deep vein thrombosis	ICD11: BD71	[17]
Methyldopa	Drug Info	Approved	Essential hypertension	ICD11: BA00	[18]
Pantoprazole sodium	Drug Info	Approved	Gastro-oesophageal reflux disease	ICD11: DA22	[19]
Celecoxib	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[20]
Cholic acid	Drug Info	Approved	Adrenomyeloneuropathy	ICD11: 5C57	[21]
Pseudoephedrine	Drug Info	Approved	Erythema multiforme	ICD11: EB12	[22]
Benzyl alcohol	Drug Info	Approved	Pediculosis	ICD11: 1G00	[23]
Ritodrine	Drug Info	Approved	Premature labour	ICD11: JB00	[24]
Heparin	Drug Info	Approved	Angina pectoris	ICD11: BA40	[25]
Neupro	Drug Info	Phase 4	Restless legs syndrome	ICD11: 7A80	[9]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 6 Drugs
Ethinylestradiol propanesulfonate	Drug Info	Phase 4	Prostate cancer	ICD11: 2C82	[26], [27]
Daidzein	Drug Info	Phase 4	Dyslipidaemia	ICD11: 5C81	[28]
Ephedrin	Drug Info	Phase 4	Contraception	ICD11: JA65	[22]
Tibolone	Drug Info	Phase 4	Depression	ICD11: 6A71	[29]
Clioquinol	Drug Info	Phase 4	Protozoan infection	ICD11: 1F5Z	[30]
Teicoplanin	Drug Info	Phase 4	Staphylococcus infection	ICD11: 1B73	[31]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 2 Drugs
E-3A	Drug Info	Phase 3	Turner syndrome	ICD11: LD50	[32]
Brivanib	Drug Info	Phase 3	Breast cancer	ICD11: 2C60-2C6Y	[33]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 3 Drugs
CERC-801	Drug Info	Phase 2	Glycosylation disorder	ICD11: 5C54	[34]
(Z)-endoxifen	Drug Info	Phase 2	Breast cancer	ICD11: 2C60-2C6Y	[35]
Endoxifen	Drug Info	Phase 2	Breast cancer	ICD11: 2C60-2C6Y	[35]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 8 Drugs
Nitrobenzanthrone	Drug Info	Investigative	Discovery agent	ICD: N.A.	[36]
Nitrobenzanthrone	Drug Info	Investigative	Discovery agent	ICD: N.A.	[37]
Phenanthrenequinone	Drug Info	Investigative	Discovery agent	ICD: N.A.	[38]
L-thyroxine	Drug Info	Investigative	Hypogonadism	ICD11: 5A61	[15]
Aminobenzoic acid	Drug Info	Investigative	Penile fibromatosis	ICD11: GB06	[39]
Hydroxymethylpyrene	Drug Info	Investigative	Discovery agent	ICD: N.A.	[40]
Triiodo-l-thyronine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[15]
Diiodo-l-thyronine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[15]
Experimental Enzyme Kinetic Data of Drugs			Click to Show/Hide the Full List of Drugs: 5 Drugs
Liothyronine	Drug Info	Approved	Hypothyroidism	Km = 0.084 microM	[15]
Benzyl alcohol	Drug Info	Approved	Pediculosis	Km = 0.0685 microM	[23]
L-thyroxine	Drug Info	Investigative	Hypogonadism	Km = 0.101 microM	[15]
Triiodo-l-thyronine	Drug Info	Investigative	Discovery agent	Km = 0.036 microM	[15]
Diiodo-l-thyronine	Drug Info	Investigative	Discovery agent	Km = 0.00051 microM	[15]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR013144	(Z)-endoxifen	EndoxifenSulfate	Unclear - Unclear	(Z)-endoxifen	[35]
MR009208	3,4-Dihydroxycinnamic Acid	Caffeic acid-3'-O-sulfate	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[41]
MR009209	3,4-Dihydroxycinnamic Acid	Caffeic acid-4'-O-sulfate	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[41]
MR009205	Ferulic acid	Ferulic acid-4'-O-sulfate	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[41]
MR009207	Isoferulic acid	Isoferulic acid-3'-O-sulfate	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[41]
MR007243	ABT-751	ABT-751 sulfate	Unclear - Unclear	ABT-751	[42]
MR000049	Acetaminophen	Acetaminophen sulfate	Conjugation - Sulfation	Acetaminophen	[43], [44], [45]
MR000245	Apixaban M2 metabolite	Apixaban M1 metabolite	Conjugation - Sulfation	Apixaban	[17], [46]
MR000250	Apomorphine	Apocodeine sulfate	Conjugation - Conjugation	Apomorphine	[5], [47]
MR012094	Brivanib Metabolites M26	Brivanib Metabolites M33	Unclear - Unclear	BMS-582664	[33]
MR012085	Brivanib Metabolites M26	Brivanib Metabolites M33	Unclear - Unclear	Brivanib	[33]
MR007072	Daidzein	Unclear	Conjugation - Sulfation	Daidzein	[28]
MR011559	Endoxifen	Endoxifen Sulfate	Unclear - Unclear	Endoxifen	[35]
MR013589	Epigallocatechin gallate	EGCG-4''-Sulfate	Unclear - Unclear	Epigallocatechin gallate	[48]
MR007156	16alpha-methoxyethinylestradiol	16alpha-methoxyethinylestradiol-sulfate	Conjugation - Sulfation	Ethinylestradiol propanesulfonate	[26], [27]
MR007144	2-methoxyethinylestradiol	2-methoxyethinylestradiol-sulfate	Conjugation - Sulfation	Ethinylestradiol propanesulfonate	[26], [27]
MR007147	4-methoxyethinylestradiol	4-methoxyethinylestradiol-sulfate	Conjugation - Sulfation	Ethinylestradiol propanesulfonate	[26], [27]
MR007150	6-methoxyethinylestradiol	6-methoxyethinylestradiol-sulfate	Conjugation - Sulfation	Ethinylestradiol propanesulfonate	[26], [27]
MR007153	7-methoxyethinylestradiol	7-methoxyethinylestradiol-sulfate	Conjugation - Sulfation	Ethinylestradiol propanesulfonate	[26], [27]
MR007158	Ethinylestradiol propanesulfonate	Ethinylestradiol-3-sulfate	Conjugation - Sulfation	Ethinylestradiol propanesulfonate	[26]
MR007052	Hydroxymethylpyrene	1-Sulfooxymethylpyrene	Conjugation - Sulfation	Hydroxymethylpyrene	[40]
MR005869	L-thyroxine	Unclear	Unclear - Unclear	L-thyroxine	[15]
MR001490	Dopamine	Dopamine-3-O-sulfate	Conjugation - Sulfation	Levodopa	[4]
MR001491	Dopamine	Dopamine-4-O-sulfate	Conjugation - Sulfation	Levodopa	[4]
MR001573	Diiodothyronine	Monoiodothyronine	Oxidation - Dehalogenation	Liothyronine	[49], [50], [51]
MR004874	O-Desmethylnaproxen	O-Desmethylnaproxen sulfate	Conjugation - Sulfonation	Naproxen	[8]
MR009262	Neupro	Neupro Metabolite M5	Unclear - Unclear	Neupro	[52], [9]
MR003531	Nintedanib esylate	Nintedanib metabolite M6	Oxidation - Demethylation	Nintedanib esylate	[53]
MR004370	3-OH-ABA	2-(2'-deoxyguanosin-N2-yl)-3-aminobenzanthrone	Unclear - Unclear	Nitrobenzanthrone	[54]
MR004371	3-OH-ABA	N-(2'-deoxyguanosin-8-yl)-3-aminobenzanthrone	Unclear - Unclear	Nitrobenzanthrone	[54]
MR004368	3-OH-ABA	3-OS-ABA	Unclear - Unclear	Nitrobenzanthrone	[54]
MR001939	Pantoprazole Sodium	Pantoprazole sulfate	Conjugation - Sulfation	Pantoprazole Sodium	[19]
MR002013	Acetaminophen	Acetaminophen sulfate	Unclear - Unclear	Phenacetin	[55]
MR004469	9,10-Phenanthrene hydroquinone	O-mono-methyl-O-mono-sulfonated catechol	Unclear - Unclear	Phenanthrenequinone	[38]
MR004466	9,10-Phenanthrene hydroquinone	O-mono-sulfonated catechol	Unclear - Unclear	Phenanthrenequinone	[38]
MR004462	Phenanthrenequinone Metabolite D2	Phenanthrenequinone Metabolite D3	Unclear - Unclear	Phenanthrenequinone	[38]
MR004464	Phenanthrenequinone Metabolite D4	Phenanthrenequinone Metabolite D5	Unclear - Unclear	Phenanthrenequinone	[38]
MR005748	Ritodrine	Ritodrine sulfated	Conjugation - Sulfation	Ritodrine	[56], [24]
MR003528	4-hydroxytamoxifen	4-hydroxytamoxifen sulfate	Conjugation - Sulfation	Tamoxifen citrate	[57]
MR003529	4-hydroxytamoxifen sulfate	Endoxifen	Conjugation - Sulfation	Tamoxifen citrate	[57]
MR003518	Endoxifen	4-hydroxytamoxifen sulfate	Conjugation - Sulfation	Tamoxifen citrate	[57]
MR003518	Endoxifen	4-hydroxytamoxifen sulfate	Conjugation - Sulfation	Tamoxifen citrate	[57]
MR003518	Endoxifen	4-hydroxytamoxifen sulfate	Conjugation - Sulfation	Tamoxifen citrate	[57]
MR003514	Tamoxifen metabolite E	Tamoxifen metabolite E sulfate conjugate	Conjugation - Sulfation	Tamoxifen citrate	[57]
MR002337	Tapentadol	Tapentadol-O-glucuronide	Conjugation - Conjugation	Tapentadol	[58], [59]
MR007760	Terbutaline	Terbutaline Sulfate	Conjugation - Sulfate conjugation	Terbutaline	[60]


⏷ Show the Full List of 46 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.93E-08; Fold-change: 3.74E-01; Z-score: 9.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.30E-01; Fold-change: 2.36E-01; Z-score: 5.81E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.66E-01; Fold-change: -1.06E-01; Z-score: -1.98E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.37E-03; Fold-change: 2.13E-01; Z-score: 3.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.62E-03; Fold-change: 4.42E-01; Z-score: 7.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.97E-02; Fold-change: -1.15E-01; Z-score: -3.70E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.91E-07; Fold-change: 4.72E-01; Z-score: 6.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.66E-98; Fold-change: -6.77E-01; Z-score: -1.73E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.92E-09; Fold-change: -7.60E-01; Z-score: -9.59E+01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.12E-02; Fold-change: 8.26E-01; Z-score: 9.43E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-07; Fold-change: -7.65E-01; Z-score: -2.96E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.69E-01; Fold-change: -2.25E-01; Z-score: -5.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.62E-03; Fold-change: -1.11E-01; Z-score: -2.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.07E-05; Fold-change: 3.02E-01; Z-score: 8.70E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.41E-03; Fold-change: 1.15E+00; Z-score: 3.73E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.24E-01; Fold-change: 1.10E-01; Z-score: 1.58E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.30E-01; Fold-change: 1.89E-01; Z-score: 5.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.21E-01; Fold-change: 3.91E-01; Z-score: 7.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.68E-09; Fold-change: -5.32E-01; Z-score: -8.75E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.33E-03; Fold-change: -4.99E-01; Z-score: -7.60E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.59E-01; Fold-change: -1.81E-01; Z-score: -3.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.57E-01; Fold-change: 4.50E-01; Z-score: 7.53E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.41E-01; Fold-change: -5.26E-01; Z-score: -8.08E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.86E-06; Fold-change: -7.32E-01; Z-score: -1.74E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.08E-122; Fold-change: -1.86E+00; Z-score: -4.11E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.86E-40; Fold-change: -1.48E+00; Z-score: -1.95E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.87E-07; Fold-change: -1.63E+00; Z-score: -5.54E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.96E-04; Fold-change: -1.48E+00; Z-score: -2.96E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.31E-02; Fold-change: 7.29E-01; Z-score: 9.19E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.00E-01; Fold-change: 4.41E-01; Z-score: 3.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.59E-12; Fold-change: -1.21E+00; Z-score: -1.58E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.80E-34; Fold-change: -8.32E-01; Z-score: -1.22E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.48E-02; Fold-change: -1.46E+00; Z-score: -2.54E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.57E-88; Fold-change: -1.17E+00; Z-score: -2.60E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.75E-47; Fold-change: -1.26E+00; Z-score: -2.36E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.67E-01; Fold-change: -6.97E-01; Z-score: -5.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.66E-02; Fold-change: -8.90E-02; Z-score: -1.64E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.95E-30; Fold-change: -6.57E-01; Z-score: -1.36E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.86E-04; Fold-change: 2.54E-01; Z-score: 5.19E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.47E-01; Fold-change: -5.91E-03; Z-score: -8.49E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.19E-02; Fold-change: 7.69E-02; Z-score: 1.83E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.80E-01; Fold-change: 7.96E-02; Z-score: 1.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.99E-01; Fold-change: 2.42E-01; Z-score: 3.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.61E-03; Fold-change: -2.57E-01; Z-score: -3.75E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.68E-04; Fold-change: 1.29E+00; Z-score: 3.54E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.87E-01; Fold-change: 3.66E-01; Z-score: 4.21E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.58E-02; Fold-change: -8.78E-02; Z-score: -2.11E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.39E-07; Fold-change: -2.97E-01; Z-score: -7.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.66E-02; Fold-change: 1.05E-01; Z-score: 4.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.30E-03; Fold-change: -4.62E-01; Z-score: -1.61E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.18E-05; Fold-change: 1.15E+00; Z-score: 5.93E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.82E-04; Fold-change: -1.89E-01; Z-score: -4.65E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.45E-03; Fold-change: -1.98E-01; Z-score: -5.59E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 4.21E-05; Fold-change: -2.33E-01; Z-score: -1.00E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-02; Fold-change: -3.57E-01; Z-score: -7.63E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.08E-01; Fold-change: 4.96E-02; Z-score: 1.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.33E-13; Fold-change: -5.98E-01; Z-score: -6.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.92E-01; Fold-change: -3.10E-01; Z-score: -7.59E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.60E-02; Fold-change: -5.24E-01; Z-score: -1.40E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.04E-01; Fold-change: 1.91E-02; Z-score: 4.46E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.67E-01; Fold-change: 2.61E-01; Z-score: 2.10E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.34E-02; Fold-change: -1.61E-01; Z-score: -8.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.16E-08; Fold-change: 5.39E-01; Z-score: 6.44E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.94E-01; Fold-change: 2.30E-01; Z-score: 4.10E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.95E-02; Fold-change: -2.25E-01; Z-score: -1.69E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.75E-01; Fold-change: -5.97E-02; Z-score: -2.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.21E-01; Fold-change: 1.16E-01; Z-score: 3.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.56E-02; Fold-change: -7.60E-01; Z-score: -1.33E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.86E-01; Fold-change: -1.80E-01; Z-score: -2.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.67E-01; Fold-change: 2.92E-01; Z-score: 5.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.13E-01; Fold-change: 9.76E-02; Z-score: 6.56E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.01E-04; Fold-change: 9.76E-01; Z-score: 1.57E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.36E-02; Fold-change: -7.37E-01; Z-score: -4.41E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.06E-01; Fold-change: -1.41E-01; Z-score: -4.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.61E-12; Fold-change: 1.01E+00; Z-score: 1.51E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.77E-01; Fold-change: -1.14E-01; Z-score: -2.77E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.78E-01; Fold-change: 1.06E-01; Z-score: 1.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.69E-01; Fold-change: -3.98E-02; Z-score: -1.90E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.90E-01; Fold-change: -2.90E-02; Z-score: -1.34E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.30E-01; Fold-change: -4.93E-02; Z-score: -6.94E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.72E-02; Fold-change: 6.46E-02; Z-score: 2.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.45E-01; Fold-change: 1.10E-01; Z-score: 2.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.58E-01; Fold-change: 3.02E-02; Z-score: 1.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.47E-01; Fold-change: 3.57E-02; Z-score: 1.73E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.72E-01; Fold-change: 2.42E-02; Z-score: 7.36E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.22E-02; Fold-change: 1.64E-01; Z-score: 5.58E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.36E-01; Fold-change: -1.56E-01; Z-score: -5.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 3.94E-01; Fold-change: -2.14E-01; Z-score: -1.20E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.82E-01; Fold-change: -2.93E-02; Z-score: -8.27E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.66E-03; Fold-change: 6.24E-01; Z-score: 1.39E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.53E-01; Fold-change: -1.33E-02; Z-score: -3.86E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.20E-01; Fold-change: -1.78E-01; Z-score: -3.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.33E-02; Fold-change: 1.73E-01; Z-score: 2.66E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.37E-01; Fold-change: -1.61E-01; Z-score: -5.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.93E-04; Fold-change: 4.88E-01; Z-score: 2.67E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.41E-05; Fold-change: 6.69E-01; Z-score: 1.57E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.40E-01; Fold-change: -2.44E-02; Z-score: -4.27E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.62E-02; Fold-change: 2.51E-01; Z-score: 3.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.80E-01; Fold-change: 1.16E-01; Z-score: 3.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.88E-01; Fold-change: 3.80E-02; Z-score: 3.18E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.16E-01; Fold-change: 2.24E-01; Z-score: 4.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.22E-01; Fold-change: 1.02E-01; Z-score: 3.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.19E-01; Fold-change: 9.00E-02; Z-score: 1.84E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.62E-02; Fold-change: -1.87E-01; Z-score: -4.46E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.72E-01; Fold-change: 6.81E-02; Z-score: 1.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.85E-02; Fold-change: 1.23E-01; Z-score: 1.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.10E-01; Fold-change: 2.08E-01; Z-score: 5.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.55E-05; Fold-change: 3.28E-01; Z-score: 8.22E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.72E-01; Fold-change: 6.65E-02; Z-score: 1.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.16E-02; Fold-change: -3.96E-01; Z-score: -6.27E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.18E-01; Fold-change: 2.57E-01; Z-score: 4.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.75E-01; Fold-change: -2.74E-01; Z-score: -4.09E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.00E-02; Fold-change: -5.31E-01; Z-score: -8.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.94E-04; Fold-change: 3.59E-01; Z-score: 2.58E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.30E-01; Fold-change: -6.03E-02; Z-score: -1.32E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.92E-25; Fold-change: -7.12E-01; Z-score: -1.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.75E-01; Fold-change: 1.30E-02; Z-score: 3.91E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.88E-01; Fold-change: -5.34E-02; Z-score: -1.38E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.48E-01; Fold-change: 5.79E-02; Z-score: 3.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.36E-01; Fold-change: 1.20E-02; Z-score: 3.27E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.74E-01; Fold-change: -5.26E-02; Z-score: -2.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.58E-01; Fold-change: 1.21E-03; Z-score: 2.57E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.36E-04; Fold-change: 6.73E-01; Z-score: 3.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.74E-08; Fold-change: -6.09E-01; Z-score: -9.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.49E-02; Fold-change: 4.31E-01; Z-score: 1.22E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.23E-01; Fold-change: 6.63E-03; Z-score: 1.33E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.58E-01; Fold-change: -3.40E-01; Z-score: -4.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.76E-01; Fold-change: 9.79E-02; Z-score: 2.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.49E-01; Fold-change: -4.54E-02; Z-score: -9.42E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.76E-01; Fold-change: -2.82E-02; Z-score: -2.35E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.62E-02; Fold-change: -5.50E-01; Z-score: -3.85E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Tamoxifen-induced adduct formation and cell stress in human endometrial glands. Drug Metab Dispos. 2010 Jan;38(1):200-7.
2	Natural products isolated from Mexican medicinal plants: novel inhibitors of sulfotransferases, SULT1A1 and SULT2A1. Phytomedicine. 2001 Nov;8(6):481-8.
3	Progestagenic effects of tibolone are target gene-specific in human endometrial cells. J Soc Gynecol Investig. 2006 Sep;13(6):459-65.
4	DrugBank(Pharmacology-Metabolism)Levodopa
5	Sulfation of apomorphine by human sulfotransferases: evidence of a major role for the polymorphic phenol sulfotransferase, SULT1A1. Xenobiotica. 2003 Nov;33(11):1139-48.
6	Hydroxysteroid sulfotransferase and a specific UDP-glucuronosyltransferase are involved in the metabolism of digitoxin in man. Naunyn Schmiedebergs Arch Pharmacol. 1992 Aug;346(2):226-33.
7	Sulfation of minoxidil by multiple human cytosolic sulfotransferases. Chem Biol Interact. 1998 Feb 20;109(1-3):53-67.
8	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
9	Identification of the human SULT enzymes involved in the metabolism of rotigotine. J Clin Pharmacol. 2016 Jun;56(6):754-60.
10	On the Molecular Basis Underlying the Metabolism of Tapentadol Through Sulfation Eur J Drug Metab Pharmacokinet. 2017 Oct;42(5):793-800. doi: 10.1007/s13318-016-0392-8.
11	Regulation of sulfate assimilation in plants: 7. Cysteine inactivation of adenosine 5'-phosphosulfate sulfotransferase in Lemna minor L. Plant Physiol. 1978 Mar;61(3):342-7.
12	Inhibition of human phenol and estrogen sulfotransferase by certain non-steroidal anti-inflammatory agents. Curr Drug Metab. 2006 Oct;7(7):745-53.
13	Sulfation of budesonide by human cytosolic sulfotransferase, dehydroepiandrosterone-sulfotransferase (DHEA-ST). Drug Metab Dispos. 2002 May;30(5):582-5.
14	Crystal structure of human sulfotransferase SULT1A3 in complex with dopamine and 3'-phosphoadenosine 5'-phosphate. Biochem Biophys Res Commun. 2005 Sep 23;335(2):417-23.
15	Characterization of human liver thermostable phenol sulfotransferase (SULT1A1) allozymes with 3,3',5-triiodothyronine as the substrate. J Endocrinol. 2001 Dec;171(3):525-32.
16	Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects. Birth Defects Res A Clin Mol Teratol. 2008 Mar;82(3):155-65.
17	Sulfation of o-demethyl apixaban: enzyme identification and species comparison. Drug Metab Dispos. 2009 Apr;37(4):802-8. doi: 10.1124/dmd.108.025593.
18	Platelet phenol sulfotransferase and erythrocyte catechol-O-methyltransferase activities: correlation with methyldopa metabolism. Clin Pharmacol Ther. 1984 Jan;35(1):55-63.
19	Interaction of proton pump inhibitors with cytochromes P450: consequences for drug interactions. Yale J Biol Med. 1996 May-Jun;69(3):203-9.
20	Sulfonation of 17beta-estradiol and inhibition of sulfotransferase activity by polychlorobiphenylols and celecoxib in channel catfish, Ictalurus punctatus. Aquat Toxicol. 2007 Mar 10;81(3):286-92.
21	Kinetic analysis of bile acid sulfation by stably expressed human sulfotransferase 2A1 (SULT2A1). Xenobiotica. 2010 Mar;40(3):184-94.
22	Benzylic alcohols as stereospecific substrates and inhibitors for aryl sulfotransferase. Chirality. 1991;3(2):104-11.
23	Sulfation of benzyl alcohol by the human cytosolic sulfotransferases (SULTs): a systematic analysis. J Appl Toxicol. 2016 Sep;36(9):1090-4.
24	Inhibitory effects of various beverages on ritodrine sulfation by recombinant human sulfotransferase isoforms SULT1A1 and SULT1A3. Pharm Res. 2005 Aug;22(8):1406-10.
25	Characterization of a heparan sulfate 3-O-sulfotransferase-5, an enzyme synthesizing a tetrasulfated disaccharide. J Biol Chem. 2003 Jul 18;278(29):26780-7.
26	Genetic variation in the first-pass metabolism of ethinylestradiol, sex hormone binding globulin levels and venous thrombosis risk Eur J Intern Med. 2017 Jul;42:54-60. doi: 10.1016/j.ejim.2017.05.019.
27	Metabolism of 17 alpha-ethinylestradiol by human liver microsomes in vitro: aromatic hydroxylation and irreversible protein binding of metabolites J Clin Endocrinol Metab. 1974 Dec;39(6):1072-80. doi: 10.1210/jcem-39-6-1072.
28	Sulfation of environmental estrogens by cytosolic human sulfotransferases. Drug Metab Pharmacokinet. 2002;17(3):221-8.
29	Sulfation of tibolone metabolites by human postmenopausal liver and small intestinal sulfotransferases (SULTs). Steroids. 2006 May;71(5):343-51.
30	Clioquinol is sulfated by human jejunum cytosol and SULT1A3, a human-specific dopamine sulfotransferase. Toxicol Lett. 2011 Oct 10;206(2):229-33.
31	The 2.7 A resolution structure of the glycopeptide sulfotransferase Teg14. Acta Crystallogr D Biol Crystallogr. 2010 Dec;66(Pt 12):1278-86.
32	Proposed role of the sulfotransferase/sulfatase pathway in modulating yolk steroid effects. Integr Comp Biol. 2008 Sep;48(3):419-27.
33	Identification of the oxidative and conjugative enzymes involved in the biotransformation of brivanib
34	Sulfation of the galactose residues in the glycosaminoglycan-protein linkage region by recombinant human chondroitin 6-O-sulfotransferase-1. J Biol Chem. 2008 Oct 10;283(41):27438-43.
35	Clinical pharmacokinetics and pharmacogenetics of tamoxifen and endoxifen
36	Carcinogenic 3-nitrobenzanthrone but not 2-nitrobenzanthrone is metabolised to an unusual mercapturic acid in rats
37	Rat cytochromes P450 oxidize 3-aminobenzanthrone, a human metabolite of the carcinogenic environmental pollutant 3-nitrobenzanthrone
38	Metabolism of a representative oxygenated polycyclic aromatic hydrocarbon (PAH) phenanthrene-9,10-quinone in human hepatoma (HepG2) cells
39	Activities of drug metabolizing enzymes in bovine colon epithelial cell cultures. Arch Toxicol. 2003 Nov;77(11):621-9.
40	BioTransformer: a comprehensive computational tool for small molecule metabolism prediction and metabolite identification
41	Absorption, disposition, metabolism, and excretion of [3-(14)C]caffeic acid in rats
42	Preclinical discovery of candidate genes to guide pharmacogenetics during phase I development: the example of the novel anticancer agent ABT-751. Pharmacogenet Genomics. 2013 Jul;23(7):374-81.
43	Simultaneous quantification of abemaciclib and its active metabolites in human and mouse plasma by UHPLC-MS/MS J Pharm Biomed Anal. 2021 Sep 5;203:114225. doi: 10.1016/j.jpba.2021.114225.
44	Application of a Volumetric Absorptive Microsampling (VAMS)-Based Method for the Determination of Paracetamol and Four of its Metabolites as a Tool for Pharmacokinetic Studies in Obese and Non-Obese Patients. Clin Pharmacokinet. 2022 Dec;61(12):1719-1733. doi: 10.1007/s40262-022-01187-2.
45	Evaluation of urinary acetaminophen metabolites and its association with the genetic polymorphisms of the metabolising enzymes, and serum acetaminophen concentrations in preterm neonates with patent ductus arteriosus. Xenobiotica. 2021 Nov;51(11):1335-1342. doi: 10.1080/00498254.2021.1982070.
46	Apixaban metabolism and pharmacokinetics after oral administration to humans Drug Metab Dispos. 2009 Jan;37(1):74-81. doi: 10.1124/dmd.108.023143.
47	Pharmacokinetics, enantiomer interconversion, and metabolism of R-apomorphine in patients with idiopathic Parkinson's disease Clin Neuropharmacol. 1998 May-Jun;21(3):159-68.
48	4-Sulfation Is the Major Metabolic Pathway of Epigallocatechin-3-gallate in Humans: Characterization of Metabolites, Enzymatic Analysis, and Pharmacokinetic Profiling
49	DrugBank(Pharmacology-Metabolism)Liothyronine
50	Role and Clinical Significance of Monocarboxylate Transporter 8 (MCT8) During Pregnancy. Reprod Sci. 2023 Jun;30(6):1758-1769. doi: 10.1007/s43032-022-01162-z.
51	Binding Characteristics of Thyroid Hormone Distributor Proteins to Thyroid Hormone Metabolites. Thyroid. 2022 Aug;32(8):990-999. doi: 10.1089/thy.2021.0588.
52	Absorption, disposition, metabolic fate, and elimination of the dopamine agonist rotigotine in man: administration by intravenous infusion or transdermal delivery
53	Metabolic pro?ling of tyrosine kinase inhibitor nintedanib using metabolomics J Pharm Biomed Anal. 2020 Feb 20;180:113045. doi: 10.1016/j.jpba.2019.113045.
54	Activation of 3-nitrobenzanthrone and its metabolites by human acetyltransferases, sulfotransferases and cytochrome P450 expressed in Chinese hamster V79 cells
55	DrugBank(Pharmacology-Metabolism)Phenacetin
56	Metabolism and disposition of ritodrine in a pregnant baboon
57	PharmGKB:Tamoxifen citrate
58	Investigations into the drug-drug interaction potential of tapentadol in human liver microsomes and fresh human hepatocytes. Drug Metab Lett. 2008 Jan;2(1):67-75.
59	In vitro and in vivo characterization of tapentadol metabolites Methods Find Exp Clin Pharmacol. 2010 Jan-Feb;32(1):31-8. doi: 10.1358/mf.2010.32.1.1434165.
60	Elimination pathways of terbutaline

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.