Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0005)
DME Name	Cytochrome P450 2A6 (CYP2A6), Homo sapiens
Synonyms	Cytochrome P450 family 2 subfamily A member 6; Coumarin 7-hydroxylase; Cytochrome P450 IIA3; Cytochrome P450(I); CYP2A3; CYP2A6; CYPIIA6
Gene Name	CYP2A6
UniProt ID	CP2A6_HUMAN
Gene ID	1548
EC Number	EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) Oxidoreductase Oxygen paired donor oxidoreductase Flavin/flavoprotein donor oxidoreductase EC: 1.14.14.1
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK ISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSN GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSN VISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQL LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFI GGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQ RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEK GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGF ATIPRNYTMSFLPR
Structure	2FDU ; 2FDV ; 2FDW ; 2FDY ; 3EBS ; 3T3Q ; 3T3R ; 4EJJ ; 4RUI
Pathway	Caffeine metabolism (hsa00232 )
	Chemical carcinogenesis (hsa05204 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Drug metabolism - other enzymes (hsa00983 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Retinol metabolism (hsa00830 )
Function	This enzyme exhibits a high coumarin 7-hydroxylase activity. It can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. It is also competent in the metabolic activation of aflatoxin B1.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 55 Drugs
Thalidomide	Drug Info	Approved	Breast cancer	ICD11: 2C60	[1]
Tamoxifen citrate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[2]
Nicotine	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[3]
Apremilast	Drug Info	Approved	Psoriasis vulgaris	ICD11: EA90	[4]
Dronabinol	Drug Info	Approved	Anorexia nervosa	ICD11: 6B80	[5]
Montelukast sodium	Drug Info	Approved	Asthma	ICD11: CA23	[6]
Progesterone	Drug Info	Approved	Premature labour	ICD11: JB00	[7]
Lidocaine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[7]
Metronidazole	Drug Info	Approved	Amebiasis	ICD11: 1A36	[8]
Ifosfamide	Drug Info	Approved	Lung cancer	ICD11: 2C25	[9]
Tretinoin	Drug Info	Approved	Acne vulgaris	ICD11: ED80	[7]
Valproic acid	Drug Info	Approved	Epilepsy	ICD11: 8A60	[10]
Halothane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[11]
Cisapride	Drug Info	Approved	Gastro-oesophageal reflux disease	ICD11: DA22	[12]
Lorcaserin	Drug Info	Approved	Obesity	ICD11: 5B81	[13]
Nevirapine	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[6]
Norethindrone acetate	Drug Info	Approved	Menorrhagia	ICD11: GA20	[14]
Belinostat	Drug Info	Approved	Anaplastic large cell lymphoma	ICD11: 2A90	[15]
Cenobamate	Drug Info	Approved	Focal seizure	ICD11: 8A68	[16]
Cyclophosphamide	Drug Info	Approved	Multiple myeloma	ICD11: 2A83	[17]
Dexmedetomidine hydrochloride	Drug Info	Approved	Tension headache	ICD11: 8A81	[18]
Efavirenz	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[19]
Flurazepam	Drug Info	Approved	Insomnia	ICD11: 7A00	[20]
Azelastine	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[21]
Clozapine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[22]
Methimazole	Drug Info	Approved	Thyrotoxicosis	ICD11: 5A02	[23], [24]
Methimazole	Drug Info	Approved	Thyrotoxicosis	ICD11: 5A02	[24]
Propofol	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[25]
Vortioxetine hydrobromide	Drug Info	Approved	Depression	ICD11: 6A71	[26]
Acetaminophen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[27]
Dapagliflozin	Drug Info	Approved	Diabetes mellitus	ICD11: 5A10	[28]
Deferiprone	Drug Info	Approved	Thalassaemia	ICD11: 3A50	[29]
Fluorouracilo	Drug Info	Approved	Stomach cancer	ICD11: 2B72	[30]
Lenvatinib	Drug Info	Approved	Thyroid cancer	ICD11: 2D10	[31]
Levomethadyl acetate hydrochloride	Drug Info	Approved	Opiate dependence	ICD11: 6C43	[32]
Timolol maleate	Drug Info	Approved	Essential hypertension	ICD11: BA00	[33]
Zidovudine	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[7]
Arformoterol	Drug Info	Approved	Chronic obstructive pulmonary disease	ICD11: CA22	[34]
Azilsartan	Drug Info	Approved	Hypertension	ICD11: BA00-BA04	[35], [36]
Clofibrate	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[37]
Moxidectin	Drug Info	Approved	Onchocerciasis	ICD11: 1F6A	[38]
Selegiline	Drug Info	Approved	Major depressive disorder	ICD11: 6A70-6A7Z	[39]
Selegiline hydrochloride	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[40]
Artesunate	Drug Info	Approved	Malaria	ICD11: 1F40-1F45	[41]
Chlorzoxazone	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[42]
Dorzolamide hydrochloride	Drug Info	Approved	Glaucoma	ICD11: 9C61	[43], [44]
Letrozole	Drug Info	Approved	Breast cancer	ICD11: 2C60	[45]
Meloxicam	Drug Info	Approved	Osteoarthritis	ICD11: FA00	[46]
Menthol	Drug Info	Approved	Throat irritation	ICD11: CA0Z	[47]
Pilocarpine	Drug Info	Approved	Glaucoma	ICD11: 9C61	[48]
Sevoflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[49]
FADROZOLE	Drug Info	Approved	Breast cancer	ICD11: 2C60-2C6Y	[50]
FADROZOLE	Drug Info	Approved	Breast cancer	ICD11: 2C60-2C6Y	[50], [51]
Methoxsalen	Drug Info	Approved	Psoriasis vulgaris	ICD11: EA90	[52]
Methoxyflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[49]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 9 Drugs
Artemisinin	Drug Info	Phase 4	Malaria	ICD11: 1F40	[52]
Tegafur-uracil	Drug Info	Phase 4	Colon cancer	ICD11: 2B90	[53]
Cinnarizine	Drug Info	Phase 4	Haemorrhagic stroke	ICD11: 8B20	[6]
Medifoxamine	Drug Info	Phase 4	Depression	ICD11: 6A71	[7]
Phenacetin	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[54]
Flunarizine	Drug Info	Phase 4	Schizophrenia	ICD11: 6A20	[37]
Flunitrazepam	Drug Info	Phase 4	Insomnia	ICD11: 7A00	[55]
Perazine	Drug Info	Phase 4	Cerebrovascular dementia	ICD11: 6D81	[56]
Tegafur	Drug Info	Phase 4	Colon cancer	ICD11: 2B90	[57]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 8 Drugs
Selumetinib	Drug Info	Phase 3	Neurofibromatosis	ICD11: LD2D	[58]
BMS-650032	Drug Info	Phase 3	Viral hepatitis	ICD11: 1E51	[59]
Y-100032	Drug Info	Phase 3	Multiple myeloma	ICD11: 2A83	[60]
HSDB-3466	Drug Info	Phase 3	Psoriasis vulgaris	ICD11: EA90	[61]
LY-450139	Drug Info	Phase 3	Alzheimer disease	ICD11: 8A20	[62]
BRN-1907611	Drug Info	Phase 3	Inflammatory bowel disease	ICD11: DD72	[63]
WY-1485	Drug Info	Phase 3	Haemorrhagic stroke	ICD11: 8B20	[7]
Montelukast	Drug Info	Phase 3	Asthma	ICD11: CA23	[6]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 4 Drugs
EMD-128130	Drug Info	Phase 2/3	Rett syndrome	ICD11: LD90	[64]
Roxatidine	Drug Info	Phase 2	Gastro-oesophageal reflux disease	ICD11: DA22	[65]
Z-4828	Drug Info	Phase 2	Histiocytic sarcoma	ICD11: 2B31	[66]
LJPC-0118	Drug Info	Phase 2	Malaria	ICD11: 1F40	[67]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 2 Drugs
Alvespimycin hydrochloride	Drug Info	Phase 1	Ovarian cancer	ICD11: 2C73	[68]
OSI-930	Drug Info	Phase 1	Solid tumour/cancer	ICD11: 2A00-2F9Z	[69]
Discontinued/withdrawn Drugs			Click to Show/Hide the Full List of Drugs: 1 Drugs
SM-10661	Drug Info	Discontinued in Phase 2	Sepsis	ICD11: 1G40-1G41	[70]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 10 Drugs
Coumarin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[71], [72]
Flavone	Drug Info	Investigative	Colon cancer	ICD11: 2B90	[73]
Flavone	Drug Info	Investigative	Colon cancer	ICD11: 2B90	[74]
Cotinine	Drug Info	Investigative	Nicotine dependence	ICD11: 6C4A	[75]
Antipyrine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[76]
Chloroxylenol	Drug Info	Investigative	Pseudomonas infection	ICD11: 1G40	[7]
Fenthion	Drug Info	Investigative	Discovery agent	ICD: N.A.	[77]
Fenthion sulfoxide	Drug Info	Investigative	Discovery agent	ICD: N.A.	[77]
Levoverbenone	Drug Info	Investigative	Pulmonary tuberculosis	ICD11: 1B10	[78]
Nicotinyl alcohol	Drug Info	Investigative	Hypertriglyceridaemia	ICD11: 5C80	[79]
Experimental Enzyme Kinetic Data of Drugs			Click to Show/Hide the Full List of Drugs: 2 Drugs
Fenthion	Drug Info	Investigative	Discovery agent	Km = 0.0016 microM	[77]
Fenthion sulfoxide	Drug Info	Investigative	Discovery agent	Km = 0.018 microM	[77]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR000050	Acetaminophen	NAPQI	Oxidation - Oxidation	Acetaminophen	[80], [81]
MR000276	Apremilast	O-desmethyl Apremilast	Oxidation - O-Demethylation	Apremilast	[82]
MR006031	Belinostat	Belinostat Amide	Unclear - Unclear	Belinostat	[15]
MR006033	Belinostat	Belinostat Acid	Unclear - Unclear	Belinostat	[15]
MR000454	BRN-1907611	5-Exo-hydroxycamphor	Oxidation - Hydroxylation	BRN-1907611	[83], [84]
MR006255	Chloroxylenol	Unclear	Unclear - Unclear	Chloroxylenol	[7]
MR013303	Cinnarizine	Cinnarizine metabolite M1	Unclear - Unclear	Cinnarizine	[6]
MR013306	Cinnarizine	Cinnamaldehyde	Oxidation - N-dealkylation	Cinnarizine	[85]
MR013307	Cinnarizine	1-Cinnamylpiperazine	Oxidation - N-dealkylation; hydrolysis	Cinnarizine	[85]
MR005300	Cotinine	Trans-3'-hydroxycotinine	Oxidation - Hydrolyzationn	Cotinine	[75]
MR005304	Cotinine	Norcotinine	Oxidation - N-demethylation	Cotinine	[75]
MR005309	Coumarin	7-Hydroxycoumarin	Oxidation - Hydroxy Aromaticlation	Coumarin	[71], [72]
MR007425	CT-1501R	Lisofylline 4,5-diol	Unclear - Unclear	CT-1501R	[86]
MR002839	Dapagliflozin	Dapagliflozin BMS-511926	Oxidation - O-Deethylation	Dapagliflozin	[87]
MR002840	Dapagliflozin	Dapagliflozin BMS-639432	Oxidation - Hydroxylation	Dapagliflozin	[87]
MR002939	Deferiprone	Deferiprone metabolite M1	Unclear - Unclear	Deferiprone	[29]
MR002935	Deferiprone metabolite M1	Deferiprone metabolite M4	Unclear - Unclear	Deferiprone	[29]
MR000803	Dexmedetomidine hydrochloride	MPV-1305	Oxidation - Hydroxylation	Dexmedetomidine hydrochloride	[88]
MR010554	Divalproex sodium	4-ene-VPA	Unclear - Unclear	Divalproex sodium	[6]
MR006651	Dorzolamide hydrochloride	N-desethyldorzolamide	Oxidation - N-deethylation	Dorzolamide hydrochloride	[43], [44]
MR006045	EMD-128130	Sarizotan metabolite M364A	Oxidation - Hydrolyzationn	EMD-128130	[64]
MR006309	Flavone	6OHF	Unclear - Unclear	Flavone	[74]
MR006310	Flavone	OHFM7	Unclear - Unclear	Flavone	[74]
MR006311	Flavone	OHFM12	Unclear - Unclear	Flavone	[74]
MR006312	Flavone	OHFM11	Unclear - Unclear	Flavone	[74]
MR006313	Flavone	OHFM9	Unclear - Unclear	Flavone	[74]
MR006314	Flavone	OHFM6	Unclear - Unclear	Flavone	[74]
MR013905	Flunarizine	Flunarizine M1	Oxidation - N-desalkylation	Flunarizine	[6]
MR013907	Flunarizine	Flunarizine M3	Oxidation - N-desalkylation	Flunarizine	[6]
MR002944	Formoterol	O-demethylated formoterol	Oxidation - O-demethylation	Formoterol	[89], [90]
MR005083	Halothane	2-chloro-1,1-difluoroethene	Reduction - Dehalogenation	Halothane	[7], [91]
MR005084	Halothane	1-chloro-2,2,2-trifluoroethanide	Reduction - Dehalogenation	Halothane	[7], [91]
MR005085	Halothane	Trifluoroacetyl chloride	Reduction - Dehalogenation	Halothane	[91]
MR005086	Halothane	Chlorotrifluoroethane	Reduction - Dehalogenation	Halothane	[91]
MR005083	Halothane	2-chloro-1,1-difluoroethene	Reduction - Dehalogenation	Halothane	[91]
MR004650	Ifosfamide	4-Hydroxyifosfamide	Oxidation - 4-hydroxylation	Ifosfamide	[92]
MR010933	Lenvatinib	O-demethyl Lenvatinib	Unclear - Unclear	Lenvatinib	[31]
MR001447	Letrozole	Letrozole ketone analog metabolite	Unclear - Unclear	Letrozole	[93]
MR001445	Letrozole ketone analog metabolite	4,4'-methanol-bisbenzonitrile	Unclear - Unclear	Letrozole	[93]
MR001555	Lidocaine	.	Unclear - Unclear	Lidocaine	[7]
MR006906	Lorcaserin	N-hydroxylorcaserin	Oxidation - Hydrolyzationn	Lorcaserin	[13]
MR003762	LY-450139	LY-2484595 Metabolite M3	Oxidation - Benzylic hydroxylation	LY-450139	[62]
MR002857	Meloxicam	5-hydroxymethyl meloxicam	Oxidation - Hydroxylation	Meloxicam	[94], [46]
MR010871	Menthol	Menthane-3,4-diol	Unclear - Unclear	Menthol	[47]
MR013817	Methimazole	N-methylthiourea	Unclear - Unclear	Methimazole	[23], [24]
MR004727	Metronidazole	2-hydroxymetronidazole	Oxidation - Hydrolyzationn	Metronidazole	[8], [95], [96], [97]
MR004799	Montelukast sodium	Montelukast sulfoxide	Oxidation - S-oxidation	Montelukast sodium	[6], [98]
MR004799	Montelukast sodium	Montelukast metabolite M2a/b	Unclear - Unclear	Montelukast sodium	[6]
MR004809	Moxidectin	Monohydroxy metabolite of moxidectin at C29	Oxidation - Hydrolyzationn	Moxidectin	[38]
MR004810	Moxidectin	Monohydroxy metabolite of moxidectin at the C14	Oxidation - Hydrolyzationn	Moxidectin	[38]
MR001717	NCI-C50000	p-Menthane-3,-8-diol	Oxidation - Hydroxylation	NCI-C50000	[99]
MR002966	Cotinine	3'-hydroxycotinine	Oxidation - 3'-Hydroxylation	Nicotine	[100]
MR002960	Nicotine	(S)-Nicotine delta-1',5'-iminium ion	Oxidation - Heteroring Dehydrogenation	Nicotine	[100]
MR002953	Nicotine	Nicotine imine	Unclear - Unclear	Nicotine	[101]
MR002961	Nicotine	2'-hydroxynicotine	Oxidation - Hydroxylation	Nicotine	[91]
MR001764	Nitrofurantoin	Nitrofurantoin metabolite M10	Oxidation - Oxidation	Nitrofurantoin	[102]
MR001765	Nitrofurantoin	Nitrofurantoin metabolite 8(M1/M2)	Oxidation - Oxidation	Nitrofurantoin	[102]
MR001766	Nitrofurantoin	Nitrofurantoin metabolite 9(M1/M2)	Oxidation - Oxidation	Nitrofurantoin	[102]
MR001762	Nitrofurantoin metabolite M10	Nitrofurantoin metabolite 8(M1/M2)	Oxidation - Oxidation	Nitrofurantoin	[102]
MR001763	Nitrofurantoin metabolite M10	Nitrofurantoin metabolite 9(M1/M2)	Oxidation - Oxidation	Nitrofurantoin	[102]
MR002014	Acetaminophen	NAPQI	Oxidation - Oxidation	Phenacetin	[103]
MR002878	Pilocarpine	3-hydroxypilocarpine	Oxidation - Hydroxylation	Pilocarpine	[48]
MR009603	Roxatidine M4	Roxatidine M5	Unclear - Unclear	Roxatidine	[65]
MR008392	SM-10661	S-Oxide	Unclear - Unclear	SM-10661	[104], [105], [70]
MR008432	STX 64	STX 64 metabolite M7	Oxidation - Hydroxylation	STX 64	[106]
MR005270	5'-hydroxytegafur	Fluorouracil	Other reaction - Degradation	Tegafur	[7], [30]
MR005269	Tegafur	5'-hydroxytegafur	Oxidation - 5-hydroxylation	Tegafur	[7], [30]
MR005271	Tegafur-uracil	5-hydroxytegafur	Oxidation - Hydrolyzationn	Tegafur-uracil	[107]
MR005279	Tegafur-uracil	3-hydroxytegafur	Oxidation - Hydrolyzationn	Tegafur-uracil	[107]
MR005280	Tegafur-uracil	4-hydroxytegafur	Oxidation - Hydrolyzationn	Tegafur-uracil	[107]
MR005281	Tegafur-uracil	Dihydrotegafur	Oxidation - Hydrolyzationn	Tegafur-uracil	[7], [30], [108]
MR004995	M1 metabolite, timolol	Timolol maleate Metabolite M4	Unclear - Unclear	Timolol maleate	[33]
MR004996	M1 metabolite, timolol	Timolol maleate Metabolite M3	Unclear - Unclear	Timolol maleate	[33]
MR004997	Timolol maleate	Timolol maleate Metabolite M2	Unclear - Unclear	Timolol maleate	[33]
MR009627	4-Hydroxyretinoic acid	4-Oxoretinoic acid	Oxidation - Oxidation	Tretinoin	[109], [110]
MR009636	Tretinoin	18-OH-RA	Oxidation - Hydroxylation	Tretinoin	[109], [110], [111]
MR009629	Tretinoin	5,6-epoxy-RA	Oxidation - Ring epoxidation	Tretinoin	[110], [110], [109]
MR009631	Tretinoin	13-cis RA	Other reaction - Isomerization	Tretinoin	[111], [110]
MR002487	2-N-Propyl-4-oxopentanoic acid	2-Propylsuccinic acid	Oxidation - 5-Hydroxylation	Valproic acid	[6]
MR002492	Valproic acid	4-hydroxyvalproic acid	Oxidation - 4-Hydroxylation	Valproic acid	[6]
MR002494	Valproic acid	5-hydroxyvalproic acid	Oxidation - 5-Hydroxylation	Valproic acid	[6]
MR002493	Valproic acid	4-ene-Valproic acid	Oxidation - 3-Hydroxylation	Valproic acid	[6]
MR002495	Valproic acid	3-hydroxyvalproic acid	Unclear - Unclear	Valproic acid	[6]
MR013079	Vonoprazan	N-demethylated TAK-438	Oxidation - N-demethylation	Vonoprazan	[112], [113]
MR013080	Vonoprazan	Vonoprazan M-	Unclear - Unclear	Vonoprazan	[114], [113]
MR005674	Vortioxetine hydrobromide	Vortioxetine Metabolite 4a	Oxidation - Oxidationn	Vortioxetine hydrobromide	[26], [115]
MR006493	WY-1485	NLA-715	Oxidation - Hydrolyzationn	WY-1485	[116], [7]
MR006497	Y-100032	Apli-dm	Oxidation - C-dealkylation	Y-100032	[60]
MR006071	Z-4828	L-ifosfamide	Oxidation - Aliphatic hydroxylation	Z-4828	[66]


⏷ Show the Full List of 89 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.56E-01; Fold-change: -7.44E-03; Z-score: -2.07E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.46E-03; Fold-change: 4.94E-01; Z-score: 4.13E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.33E-01; Fold-change: 4.58E-02; Z-score: 2.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.62E-10; Fold-change: 1.45E-01; Z-score: 6.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.79E-01; Fold-change: -2.31E-03; Z-score: -1.24E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.67E-01; Fold-change: -9.72E-02; Z-score: -1.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.34E-02; Fold-change: -8.46E-02; Z-score: -3.27E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.89E-07; Fold-change: -8.67E-02; Z-score: -3.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.06E-02; Fold-change: -1.34E-01; Z-score: -6.13E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.09E-08; Fold-change: -6.43E-01; Z-score: -3.81E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.90E-05; Fold-change: -1.12E+00; Z-score: -2.37E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.75E-01; Fold-change: 1.41E-02; Z-score: 7.72E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.52E-03; Fold-change: 9.77E-02; Z-score: 5.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.55E-01; Fold-change: 9.45E-02; Z-score: 3.90E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.74E-02; Fold-change: -2.30E-01; Z-score: -1.83E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.39E-01; Fold-change: 3.69E-02; Z-score: 2.11E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.88E-01; Fold-change: 7.42E-02; Z-score: 3.54E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.57E-02; Fold-change: -2.75E-01; Z-score: -1.41E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.37E-01; Fold-change: 2.12E-02; Z-score: 7.71E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.08E-03; Fold-change: -3.33E-01; Z-score: -1.10E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.87E-01; Fold-change: -6.85E-02; Z-score: -1.91E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.04E-01; Fold-change: -7.17E-02; Z-score: -6.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.33E-01; Fold-change: -1.87E-01; Z-score: -1.17E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.74E-03; Fold-change: 1.70E-01; Z-score: 7.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.92E-04; Fold-change: -1.16E-01; Z-score: -4.54E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.13E-01; Fold-change: -3.72E-02; Z-score: -1.46E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.73E-01; Fold-change: -8.05E-02; Z-score: -3.56E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.48E-01; Fold-change: 6.88E-04; Z-score: 2.59E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.83E-01; Fold-change: -1.43E-01; Z-score: -4.14E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.93E-01; Fold-change: -2.00E-01; Z-score: -6.43E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.71E-13; Fold-change: -4.22E+00; Z-score: -2.32E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.51E-62; Fold-change: -3.15E+00; Z-score: -3.35E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 8.38E-04; Fold-change: -4.34E+00; Z-score: -6.40E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.48E-01; Fold-change: -5.89E-02; Z-score: -1.77E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.90E-04; Fold-change: -1.99E-01; Z-score: -5.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.24E-01; Fold-change: 1.08E-01; Z-score: 1.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.83E-08; Fold-change: -2.77E-01; Z-score: -5.15E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.59E-23; Fold-change: 9.47E-01; Z-score: 1.51E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.15E-06; Fold-change: -4.25E-01; Z-score: -9.04E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.54E-01; Fold-change: -1.77E-01; Z-score: -4.40E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.94E-01; Fold-change: -9.00E-02; Z-score: -4.71E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.81E-01; Fold-change: 4.97E-03; Z-score: 1.99E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.04E-03; Fold-change: -2.19E-01; Z-score: -9.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.55E-04; Fold-change: -1.16E-01; Z-score: -4.21E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.51E-02; Fold-change: 2.06E-01; Z-score: 1.67E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.39E-05; Fold-change: -1.04E+00; Z-score: -1.40E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.77E-02; Fold-change: -2.66E-01; Z-score: -7.98E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.02E-14; Fold-change: -5.82E-01; Z-score: -1.62E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.47E-01; Fold-change: -5.85E-02; Z-score: -2.83E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.75E-04; Fold-change: 5.92E-01; Z-score: 2.29E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.27E-03; Fold-change: -3.92E-01; Z-score: -1.99E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.50E-04; Fold-change: 1.16E-01; Z-score: 4.39E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.38E-01; Fold-change: 4.78E-03; Z-score: 1.45E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 5.44E-03; Fold-change: -1.10E-01; Z-score: -6.37E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.21E-01; Fold-change: 3.51E-01; Z-score: 8.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.50E-02; Fold-change: 3.49E-01; Z-score: 1.14E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.94E-13; Fold-change: -4.03E-01; Z-score: -6.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.21E-02; Fold-change: 2.41E-01; Z-score: 1.09E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.76E-01; Fold-change: 9.13E-02; Z-score: 4.54E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.16E-02; Fold-change: 1.80E-01; Z-score: 9.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.87E-01; Fold-change: 9.07E-02; Z-score: 2.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.07E-01; Fold-change: 5.60E-02; Z-score: 5.82E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-02; Fold-change: -3.16E-01; Z-score: -4.56E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.08E-05; Fold-change: 1.77E-01; Z-score: 1.65E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.61E-01; Fold-change: 1.05E-02; Z-score: 4.41E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.20E-01; Fold-change: -8.21E-02; Z-score: -5.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.84E-01; Fold-change: 1.09E-01; Z-score: 5.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.66E-01; Fold-change: -7.53E-02; Z-score: -3.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.86E-01; Fold-change: 9.21E-02; Z-score: 6.54E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.97E-01; Fold-change: 2.69E-01; Z-score: 5.70E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.07E-01; Fold-change: -5.63E-02; Z-score: -3.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.21E-02; Fold-change: -1.47E-01; Z-score: -1.06E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.40E-01; Fold-change: 1.05E-01; Z-score: 9.15E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.05E-01; Fold-change: -7.80E-02; Z-score: -3.56E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.16E-05; Fold-change: -5.46E-01; Z-score: -1.71E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.98E-01; Fold-change: -2.30E-02; Z-score: -8.80E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.24E-01; Fold-change: 6.79E-02; Z-score: 2.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.82E-01; Fold-change: -4.18E-02; Z-score: -2.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.78E-01; Fold-change: -6.08E-03; Z-score: -4.13E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.48E-01; Fold-change: -2.24E-02; Z-score: -7.80E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.21E-02; Fold-change: 9.40E-02; Z-score: 6.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.99E-01; Fold-change: 4.59E-03; Z-score: 2.19E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.51E-01; Fold-change: 5.05E-02; Z-score: 3.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.02E-01; Fold-change: -2.49E-02; Z-score: -1.81E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.29E-02; Fold-change: -7.09E-02; Z-score: -3.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.56E-01; Fold-change: -6.70E-02; Z-score: -3.47E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.41E-01; Fold-change: -2.43E-01; Z-score: -1.37E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 4.75E-02; Fold-change: 2.15E-01; Z-score: 4.26E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.69E-02; Fold-change: -1.31E-01; Z-score: -7.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.49E-01; Fold-change: 2.01E-01; Z-score: 6.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.52E-07; Fold-change: 2.73E-01; Z-score: 1.88E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.94E-01; Fold-change: 2.54E-02; Z-score: 1.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.76E-01; Fold-change: 8.14E-02; Z-score: 9.84E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.60E-01; Fold-change: 1.59E-02; Z-score: 5.91E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.68E-01; Fold-change: -8.94E-02; Z-score: -3.91E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.92E-02; Fold-change: -6.11E-02; Z-score: -4.77E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.48E-01; Fold-change: -1.59E-02; Z-score: -1.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.53E-02; Fold-change: 1.64E-01; Z-score: 2.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.54E-01; Fold-change: 2.14E-02; Z-score: 8.50E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.73E-01; Fold-change: 2.55E-02; Z-score: 3.48E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.22E-02; Fold-change: -2.39E-01; Z-score: -1.22E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.87E-02; Fold-change: 2.08E-01; Z-score: 1.53E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.90E-02; Fold-change: -5.08E-01; Z-score: -1.19E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.70E-01; Fold-change: 2.63E-01; Z-score: 6.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.35E-03; Fold-change: -2.46E-01; Z-score: -5.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.41E-01; Fold-change: 3.13E-01; Z-score: 2.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-01; Fold-change: 2.71E-01; Z-score: 8.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.45E-03; Fold-change: 9.41E-02; Z-score: 2.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.54E-01; Fold-change: -1.49E-02; Z-score: -6.55E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.76E-01; Fold-change: -3.41E-01; Z-score: -6.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.37E-02; Fold-change: -1.33E+00; Z-score: -1.11E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.77E-01; Fold-change: 6.19E-02; Z-score: 2.01E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.31E-01; Fold-change: 2.64E-02; Z-score: 1.27E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.48E-01; Fold-change: 8.29E-02; Z-score: 9.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.19E-13; Fold-change: -3.40E-01; Z-score: -7.68E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.69E-48; Fold-change: 1.12E+00; Z-score: 4.84E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.56E-01; Fold-change: -1.48E-02; Z-score: -1.10E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.91E-01; Fold-change: 1.03E-01; Z-score: 3.69E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.41E-01; Fold-change: 1.65E-02; Z-score: 8.11E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.07E-01; Fold-change: -1.87E-02; Z-score: -1.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.41E-01; Fold-change: 1.23E-02; Z-score: 5.46E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.22E-01; Fold-change: 1.37E-01; Z-score: 3.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.32E-02; Fold-change: -5.21E-01; Z-score: -1.72E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.70E-03; Fold-change: 6.62E-03; Z-score: 3.43E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.39E-01; Fold-change: 4.37E-02; Z-score: 3.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-03; Fold-change: 3.88E-01; Z-score: 3.09E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.99E-02; Fold-change: 1.17E-01; Z-score: 5.72E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.24E-01; Fold-change: 1.21E-01; Z-score: 8.15E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.54E-01; Fold-change: 2.76E-02; Z-score: 3.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.63E-01; Fold-change: -5.44E-02; Z-score: -5.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.54E-02; Fold-change: 1.22E-01; Z-score: 1.17E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Metabolism of thalidomide in human microsomes, cloned human cytochrome P-450 isozymes, and Hansen's disease patients. J Biochem Mol Toxicol. 2000;14(3):140-7.
2	Genotoxicity of tamoxifen, tamoxifen epoxide and toremifene in human lymphoblastoid cells containing human cytochrome P450s. Carcinogenesis. 1994 Jan;15(1):5-9.
3	CYP2A6- and CYP2A13-catalyzed metabolism of the nicotine delta-5'(1')iminium ion. J Pharmacol Exp Ther. 2012 Nov;343(2):307-15.
4	Apremilast (Otezla): a new oral treatment for adults with psoriasis and psoriatic arthritis. P T. 2015 Aug;40(8):495-500.
5	Health control over the feeding of troops on the Western and 3d Belorussian Fronts during the Great Patriotic War years. Voen Med Zh. 1975 Jun;(6):86-8.
6	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
7	Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
8	The role of human cytochrome P450 enzymes in the formation of 2-hydroxymetronidazole: CYP2A6 is the high affinity (low Km) catalyst. Drug Metab Dispos. 2013 Sep;41(9):1686-94.
9	Measurement of 4-hydroxylation of ifosfamide in human liver microsomes using the estimation of free and protein-bound acrolein and codetermination of keto- and carboxyifosfamide. J Cancer Res Clin Oncol. 2002 Jul;128(7):385-92.
10	Psychotropic drug interactions with valproate. Clin Neuropharmacol. 2005 Mar-Apr;28(2):96-101.
11	Halothane-dependent lipid peroxidation in human liver microsomes is catalyzed by cytochrome P4502A6 (CYP2A6). Anesthesiology. 2001 Aug;95(2):509-14.
12	Identification of the cytochrome P450 enzymes involved in the metabolism of cisapride: in vitro studies of potential co-medication interactions. Br J Pharmacol. 2000 Apr;129(8):1655-67.
13	Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
14	Drug Interactions Flockhart Table
15	Pharmacokinetics, metabolism, and excretion of (14)C-labeled belinostat in patients with recurrent or progressive malignancies
16	FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
17	Development of a substrate-activity based approach to identify the major human liver P-450 catalysts of cyclophosphamide and ifosfamide activation based on cDNA-expressed activities and liver microsomal P-450 profiles. Drug Metab Dispos. 1999 Jun;27(6):655-66.
18	Impact of CYP2A6 gene polymorphism on the pharmacokinetics of dexmedetomidine for premedication. Expert Rev Clin Pharmacol. 2018 Sep;11(9):917-922.
19	Biotransformation of Efavirenz and Proteomic Analysis of Cytochrome P450s and UDP-Glucuronosyltransferases in Mouse, Macaque, and Human Brain-Derived In Vitro Systems. Drug Metab Dispos. 2023 Apr;51(4):521-531. doi: 10.1124/dmd.122.001195.
20	Is 1-aminobenzotriazole an appropriate in vitro tool as a nonspecific cytochrome P450 inactivator? Drug Metab Dispos. 2009 Jan;37(1):10-3.
21	Azelastine N-demethylation by cytochrome P-450 (CYP)3A4, CYP2D6, and CYP1A2 in human liver microsomes: evaluation of approach to predict the contribution of multiple CYPs. Drug Metab Dispos. 1999 Dec;27(12):1381-91.
22	Characterization of human cytochrome P450s involved in the bioactivation of clozapine. Drug Metab Dispos. 2013 Mar;41(3):651-8.
23	Evidence for the involvement of N-methylthiourea, a ring cleavage metabolite, in the hepatotoxicity of methimazole in glutathione-depleted mice: structure-toxicity and metabolic studies
24	Role of CYP2A6 in Methimazole Bioactivation and Hepatotoxicity
25	Possible involvement of multiple human cytochrome P450 isoforms in the liver metabolism of propofol. Br J Anaesth. 1998 Jun;80(6):788-95.
26	Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
27	Metabolic interactions between acetaminophen (paracetamol) and two flavonoids, luteolin and quercetin, through in-vitro inhibition studies. J Pharm Pharmacol. 2017 Dec;69(12):1762-1772.
28	Clinical pharmacokinetics and pharmacodynamics of dapagliflozin, a selective inhibitor of sodium-glucose co-transporter type 2. Clin Pharmacokinet. 2014 Jan;53(1):17-27.
29	Metabolic activation of deferiprone mediated by CYP2A6 Xenobiotica. 2021 Nov;51(11):1282-1291. doi: 10.1080/00498254.2021.1931729.
30	Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
31	The impact of individual human cytochrome P450 enzymes on oxidative metabolism of anticancer drug lenvatinib
32	N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
33	Timolol metabolism in human liver microsomes is mediated principally by CYP2D6. Drug Metab Dispos. 2007 Jul;35(7):1135-41.
34	A comparison of the expression and metabolizing activities of phase I and II enzymes in freshly isolated human lung parenchymal cells and cryopreserved human hepatocytes. Drug Metab Dispos. 2007 Oct;35(10):1797-805.
35	Drug Interactions with Angiotensin Receptor Blockers: Role of Human Cytochromes P450
36	Lithium Intoxication in the Elderly: A Possible Interaction between Azilsartan, Fluvoxamine, and Lithium
37	Oxidative metabolism of flunarizine and cinnarizine by microsomes from B-lymphoblastoid cell lines expressing human cytochrome P450 enzymes. Biol Pharm Bull. 1996 Nov;19(11):1511-4.
38	Moxidectin and the avermectins: Consanguinity but not identity
39	Physiologically Based Pharmacokinetic Modeling of Transdermal Selegiline and Its Metabolites for the Evaluation of Disposition Differences between Healthy and Special Populations
40	Variation in CYP2A6 activity and personalized medicine. J Pers Med. 2017 Dec 1;7(4). pii: E18.
41	High prevalence of CYP2A64 and CYP2A69 alleles detected among a Malaysian population
42	Prediction of human liver microsomal oxidations of 7-ethoxycoumarin and chlorzoxazone with kinetic parameters of recombinant cytochrome P-450 enzymes. Drug Metab Dispos. 1999 Nov;27(11):1274-80.
43	Dorzolamide. A review of its pharmacology and therapeutic potential in the management of glaucoma and ocular hypertension
44	In vitro metabolism of dorzolamide, a novel potent carbonic anhydrase inhibitor, in rat liver microsomes. Drug Metab Dispos. 1994 Nov-Dec;22(6):916-21.
45	Letrozole concentration is associated with CYP2A6 variation but not with arthralgia in patients with breast cancer. Breast Cancer Res Treat. 2018 Nov;172(2):371-379.
46	Metabolism of Meloxicam in human liver involves cytochromes P4502C9 and 3A4. Xenobiotica. 1998 Jan;28(1):1-13.
47	Metabolism of (+)- and (-)-menthols by CYP2A6 in human liver microsomes
48	Involvement of CYP2A6 in the formation of a novel metabolite, 3-hydroxypilocarpine, from pilocarpine in human liver microsomes
49	Human kidney methoxyflurane and sevoflurane metabolism. Intrarenal fluoride production as a possible mechanism of methoxyflurane nephrotoxicity. Anesthesiology. 1995 Mar;82(3):689-99.
50	Structure, function, regulation and polymorphism of human cytochrome P450 2A6. Curr Drug Metab. 2009 Sep;10(7):754-80.
51	CYP2A6: a human coumarin 7-hydroxylase
52	Identification of the human cytochrome P450 enzymes involved in the in vitro metabolism of artemisinin. Br J Clin Pharmacol. 1999 Oct;48(4):528-35.
53	UFT Capsules (uracil-tegafur).
54	Activation of phenacetin O-deethylase activity by alpha-naphthoflavone in human liver microsomes. Xenobiotica. 1999 Sep;29(9):885-98.
55	CYP3A4 is the major CYP isoform mediating the in vitro hydroxylation and demethylation of flunitrazepam. Drug Metab Dispos. 2001 Feb;29(2):133-40.
56	The metabolism of the piperazine-type phenothiazine neuroleptic perazine by the human cytochrome P-450 isoenzymes. Eur Neuropsychopharmacol. 2004 May;14(3):199-208.
57	Rapid development of S-1 in the west for therapy of advanced gastric carcinoma. Gan To Kagaku Ryoho. 2006 Jun;33 Suppl 1:117-20.
58	Metabolism, Excretion, and Pharmacokinetics of Selumetinib, an MEK1/2 inhibitor, in Healthy Adult Male Subjects
59	Australian Public Assessment Report for asunaprevir.
60	In vitro characterization of the human biotransformation pathways of aplidine, a novel marine anti-cancer drug. Invest New Drugs. 2007 Feb;25(1):9-19.
61	Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
62	Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
63	In vitro metabolism of (-)-camphor using human liver microsomes and CYP2A6. Biol Pharm Bull. 2007 Feb;30(2):230-3.
64	In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
65	Cytochrome P450 enzymes involved in the metabolic pathway of the histamine 2 (H2)-receptor antagonist roxatidine acetate by human liver microsomes. Arzneimittelforschung. 2001;51(8):651-8.
66	Metabolism and transport of oxazaphosphorines and the clinical implications Drug Metab Rev. 2005;37(4):611-703. doi: 10.1080/03602530500364023.
67	Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
68	In vitro metabolism of 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin in human liver microsomes
69	Inactivation of cytochrome P450 (P450) 3A4 but not P450 3A5 by OSI-930, a thiophene-containing anticancer drug
70	A new deleted allele in the human cytochrome P450 2A6 (CYP2A6) gene found in individuals showing poor metabolic capacity to coumarin and (+)-cis-3,5-dimethyl-2-(3-pyridyl)thiazolidin-4-one hydrochloride (SM-12502)
71	Identification of the cytochromes P450 that catalyze coumarin 3,4-epoxidation and 3-hydroxylation
72	Species differences and interindividual variation in liver microsomal cytochrome P450 2A enzymes: effects on coumarin, dicumarol, and testosterone oxidation
73	Site-specific oxidation of flavanone and flavone by cytochrome P450 2A6 in human liver microsomes. Xenobiotica. 2019 Jul;49(7):791-802.
74	Urinary metabolites of dibutyl phthalate and benzophenone-3 are potential chemical risk factors of chronic kidney function markers among healthy women
75	Interindividual variability in nicotine metabolism: C-oxidation and glucuronidation
76	Identification of the human hepatic cytochromes P450 involved in the in vitro oxidation of antipyrine. Drug Metab Dispos. 1996 Apr;24(4):487-94.
77	The participation of human hepatic P450 isoforms, flavin-containing monooxygenases and aldehyde oxidase in the biotransformation of the insecticide fenthion. Toxicol Appl Pharmacol. 2008 Dec 1;233(2):343-52.
78	Roles of human CYP2A6 and 2B6 and rat CYP2C11 and 2B1 in the 10-hydroxylation of (-)-verbenone by liver microsomes. Drug Metab Dispos. 2003 Aug;31(8):1049-53.
79	Stability of the nicotine metabolite ratio in ad libitum and reducing smokers. Cancer Epidemiol Biomarkers Prev. 2008 Jun;17(6):1396-400.
80	Acetaminophen, via its reactive metabolite N-acetyl-p-benzo-quinoneimine and transient receptor potential ankyrin-1 stimulation, causes neurogenic inflammation in the airways and other tissues in rodents FASEB J. 2010 Dec;24(12):4904-16. doi: 10.1096/fj.10-162438.
81	Rapid detection and quantification of paracetamol and its major metabolites using surface enhanced Raman scattering. Analyst. 2023 Apr 11;148(8):1805-1814. doi: 10.1039/d3an00249g.
82	Disposition, metabolism and mass balance of [(14)C]apremilast following oral administration. Xenobiotica. 2011 Dec;41(12):1063-75.
83	A cytochrome P450 class I electron transfer system from Novosphingobium aromaticivorans. Appl Microbiol Biotechnol. 2010 Mar;86(1):163-75.
84	DrugBank(Pharmacology-Metabolism)BRN-1907611
85	DrugBank : Cinnarizine
86	Physiologically based modeling of lisofylline pharmacokinetics following intravenous administration in mice. Eur J Drug Metab Pharmacokinet. 2016 Aug;41(4):403-12.
87	In vitro characterization and pharmacokinetics of dapagliflozin (BMS-512148), a potent sodium-glucose cotransporter type II inhibitor, in animals and humans Drug Metab Dispos. 2010 Mar;38(3):405-14. doi: 10.1124/dmd.109.029165.
88	Analytical method development for the simultaneous quantitation of dexmedetomidine and three potential metabolites in plasma J Chromatogr A. 1997 Feb 21;762(1-2):281-91. doi: 10.1016/s0021-9673(96)00965-x.
89	Mass balance and metabolism of [(3)H]Formoterol in healthy men after combined i.v. and oral administration-mimicking inhalation Drug Metab Dispos. 1999 Oct;27(10):1104-16.
90	FDA Approved Drug Products: Perforomist? inhalation solution
91	Cytochromes P450: a structure-based summary of biotransformations using representative substrates Drug Metab Rev. 2008;40(1):1-100. doi: 10.1080/03602530802309742.
92	The KEGG resource for deciphering the genome
93	Inhibition of drug metabolizing cytochrome P450s by the aromatase inhibitor drug letrozole and its major oxidative metabolite 4,4'-methanol-bisbenzonitrile in vitro. Cancer Chemother Pharmacol. 2009 Oct;64(5):867-75.
94	A prospective longitudinal study of growth in twin gestations compared with growth in singleton pregnancies. I. The fetal head J Ultrasound Med. 1991 Aug;10(8):439-43. doi: 10.7863/jum.1991.10.8.439.
95	Disposition and metabolism of metronidazole in patients with liver failure
96	Metronidazole Metabolism in Neonates and the Interplay Between Ontogeny and Genetic Variation
97	Metronidazole: an update on metabolism, structure-cytotoxicity and resistance mechanisms
98	In vitro metabolism of montelukast by cytochrome P450s and UDP-glucuronosyltransferases. Drug Metab Dispos. 2015 Dec;43(12):1905-16.
99	NORMAN Suspect List Exchange:Levomenthol
100	Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
101	U. S. FDA Label -Nicotine
102	Oxidative bioactivation of nitrofurantoin in rat liver microsomes Xenobiotica. 2017 Feb;47(2):103-111. doi: 10.3109/00498254.2016.1164913.
103	DrugBank(Pharmacology-Metabolism)Phenacetin
104	(+)-cis-3,5-dimethyl-2-(3-pyridyl) thiazolidin-4-one hydrochloride (SM-12502) as a novel substrate for cytochrome P450 2A6 in human liver microsomes
105	S-oxidation of (+)-cis-3,5-dimethyl-2-(3-pyridyl)-thiazolidin-4-one hydrochloride by rat hepatic flavin-containing monooxygenase 1 expressed in yeast
106	In vitro metabolism of irosustat, a novel steroid sulfatase inhibitor: interspecies comparison, metabolite identification, and metabolic enzyme identification
107	DrugBank(Pharmacology-Metabolism):Tegafur-uracil
108	Comparative pharmacology of oral fluoropyrimidines: a focus on pharmacokinetics, pharmacodynamics and pharmacomodulation
109	Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
110	Retinoic acid metabolism and mechanism of action: a review
111	Human cytochrome P450s involved in the metabolism of 9-cis- and 13-cis-retinoic acids
112	Assessments of CYP?inhibition?based drug-drug interaction between vonoprazan and poziotinib in?vitro and in?vivo
113	In vitro metabolism of TAK-438, vonoprazan fumarate, a novel potassium-competitive acid blocker. Xenobiotica. 2017 Dec;47(12):1027-1034.
114	Vonoprazan fumarate, a novel potassium-competitive acid blocker, in the management of gastroesophageal reflux disease: safety and clinical evidence to date
115	Vortioxetine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2018 Jun;57(6):673-686.
116	BioTransformer: a comprehensive computational tool for small molecule metabolism prediction and metabolite identification

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.