Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0013)
DME Name	Cytochrome P450 2E1 (CYP2E1), Homo sapiens
Synonyms	Cytochrome P450 family 2 subfamily E member 1; 4-nitrophenol 2-hydroxylase; Cytochrome P450-J; CYP2E; CYP2E1; CYPIIE1
Gene Name	CYP2E1
UniProt ID	CP2E1_HUMAN
Gene ID	1571
EC Number	EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) Oxidoreductase Oxygen paired donor oxidoreductase Flavin/flavoprotein donor oxidoreductase EC: 1.14.14.1
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC IPPRYKLCVIPRS
Structure	3E4E ; 3E6I ; 3GPH ; 3KOH ; 3LC4 ; 3T3Z
Pathway	Arachidonic acid metabolism (hsa00590 )
	Chemical carcinogenesis (hsa05204 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Drug metabolism - other enzymes (hsa00983 )
	Linoleic acid metabolism (hsa00591 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
	Steroid hormone biosynthesis (hsa00140 )
Function	This enzyme is involved in the metabolism of fatty acids. It catalyzes the hydroxylation of carbon-hydrogen bonds and hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids.In addition, it may be involved in the oxidative metabolism of xenobiotics.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 82 Drugs
Thalidomide	Drug Info	Approved	Breast cancer	ICD11: 2C60	[1]
Bupropion	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[2]
Tamoxifen citrate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[3]
Yn-968D1	Drug Info	Approved	Breast cancer	ICD11: 2C60-2C6Y	[4]
Estrone	Drug Info	Approved	Menopausal disorder	ICD11: GA30	[5]
Nicotine	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[6]
Fospropofol disodium	Drug Info	Approved	Monitored anaesthesia care	ICD11: N.A.	[7]
Almogran	Drug Info	Approved	Migraine	ICD11: 8A80	[8]
Almogran	Drug Info	Approved	Migraine	ICD11: 8A80	[9]
Cannabidiol	Drug Info	Approved	Lennox-Gastaut syndrome	ICD11: 8A62	[10]
Capsaicin	Drug Info	Approved	Herpes zoster	ICD11: 1E91	[11]
Ifosfamide	Drug Info	Approved	Lung cancer	ICD11: 2C25	[12]
Almotriptan malate	Drug Info	Approved	Migraine	ICD11: 8A80	[13]
Disulfiram	Drug Info	Approved	Alcohol dependence	ICD11: 6C40	[14]
Isoniazid	Drug Info	Approved	Pulmonary tuberculosis	ICD11: 1B10	[15]
Trabectedin	Drug Info	Approved	Leiomyosarcoma	ICD11: 2B58	[16]
Fluvoxamine maleate	Drug Info	Approved	Obsessive-compulsive disorder	ICD11: 6B20	[17]
Halothane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[18]
Caffeine	Drug Info	Approved	Orthostatic hypotension	ICD11: BA21	[19]
Carvedilol	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[20]
Lorcaserin	Drug Info	Approved	Obesity	ICD11: 5B81	[21]
Ondansetron	Drug Info	Approved	Gastritis	ICD11: DA42	[22]
Verapamil hydrochloride	Drug Info	Approved	Essential hypertension	ICD11: BA00	[23]
Amitriptyline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[24]
Cenobamate	Drug Info	Approved	Focal seizure	ICD11: 8A68	[25]
Dexmedetomidine hydrochloride	Drug Info	Approved	Tension headache	ICD11: 8A81	[26]
Felbamate	Drug Info	Approved	Epilepsy	ICD11: 8A60	[23]
Fluoxetine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[17]
Phenytoin	Drug Info	Approved	Epilepsy	ICD11: 8A60	[27]
Quinidine	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[28]
Citalopram hydrobromide	Drug Info	Approved	Depression	ICD11: 6A71	[17]
Eszopiclone	Drug Info	Approved	Insomnia	ICD11: 7A00	[29]
Ethosuximide	Drug Info	Approved	Epilepsy	ICD11: 8A60	[30]
Fingolimod	Drug Info	Approved	Multiple sclerosis	ICD11: 8A40	[31]
Fingolimod hydrochloride	Drug Info	Approved	Multiple sclerosis	ICD11: 8A40	[31]
Levocarnitine	Drug Info	Approved	Cognitive impairment	ICD11: 6D71	[32]
Pentobarbital	Drug Info	Approved	Insomnia	ICD11: 7A00	[33]
Propofol	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[34]
Theophylline	Drug Info	Approved	Chronic obstructive pulmonary disease	ICD11: CA22	[35]
VESNARINONE	Drug Info	Approved	Cardiac failure	ICD11: BD10-BD1Z	[36]
Acetaminophen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[37]
Benzocaine	Drug Info	Approved	Anaesthesia	ICD11: 9A76-9A78	[38]
Cisplatin	Drug Info	Approved	Lung cancer	ICD11: 2C25	[39]
Etoposide	Drug Info	Approved	Lung cancer	ICD11: 2C25	[40]
Levomethadyl acetate hydrochloride	Drug Info	Approved	Opiate dependence	ICD11: 6C43	[41]
Mexiletine hydrochloride	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[42]
Olopatadine	Drug Info	Approved	Conjunctivitis	ICD11: 9A60	[43]
Phenobarbital	Drug Info	Approved	Epilepsy	ICD11: 8A60	[44]
Sulfadiazine	Drug Info	Approved	Toxoplasmosis	ICD11: 1F57	[23]
Azilsartan	Drug Info	Approved	Hypertension	ICD11: BA00-BA04	[45], [46]
Dalfampridine	Drug Info	Approved	Multiple sclerosis	ICD11: 8A40	[47]
Dapsone	Drug Info	Approved	Pneumocystis pneumonia	ICD11: CA40	[48]
Folic acid	Drug Info	Approved	Vitamin deficiency	ICD11: 5B55	[49]
Fomepizole	Drug Info	Approved	Methanol/ethylene-glycol poisoning	ICD11: DA40	[50]
Furosemide	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[51]
Mitoxantrone	Drug Info	Approved	Prostate cancer	ICD11: 2C82	[52]
Nicardipine hydrochloride	Drug Info	Approved	Essential hypertension	ICD11: BA00	[23]
Oxaliplatin	Drug Info	Approved	Colorectal cancer	ICD11: 2B91	[53]
Primidone	Drug Info	Approved	Epilepsy	ICD11: 8A60	[54]
Sertraline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[55]
Sildenafil citrate	Drug Info	Approved	Erectile dysfunction	ICD11: HA01	[56]
Benzyl alcohol	Drug Info	Approved	Pediculosis	ICD11: 1G00	[57]
Chlorzoxazone	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[58]
Clevidipine	Drug Info	Approved	Essential hypertension	ICD11: BA00	[59]
Dacarbazine	Drug Info	Approved	Melanoma	ICD11: 2C30	[60]
Dorzolamide hydrochloride	Drug Info	Approved	Glaucoma	ICD11: 9C61	[61]
Enflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[62]
Enfuvirtide	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[63]
Ibudilast	Drug Info	Approved	Castleman's disease	ICD11: 4B2Y	[64]
Isoflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[65]
Meloxicam	Drug Info	Approved	Osteoarthritis	ICD11: FA00	[66]
Rifampicin	Drug Info	Approved	Osteoporosis	ICD11: FB83	[67]
Ripretinib	Drug Info	Approved	Gastrointestinal stromal tumour	ICD11: 2B5B	[68]
Sevoflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[34]
Trimethadione	Drug Info	Approved	Epilepsy	ICD11: 8A60	[69]
Aminophylline	Drug Info	Approved	Asthma	ICD11: CA23	[70]
Menadione	Drug Info	Approved	Vitamin deficiency	ICD11: 5B55	[71]
Meprobamate	Drug Info	Approved	Anxiety disorder	ICD11: 6B00	[72]
Methoxyflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[35]
Nabilone	Drug Info	Approved	Insomnia	ICD11: 7A00-7A0Z	[73]
Berberine	Drug Info	Phase 4	Discovery agent	ICD: N.A.	[74]
3,4-Dihydroxycinnamic Acid	Drug Info	Phase 4	Thrombocytopenia	ICD11: 3B64	[75]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 9 Drugs
Ademetionine	Drug Info	Phase 4	Cerebral ischaemia	ICD11: 8B1Z	[15]
Phenacetin	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[76]
Perazine	Drug Info	Phase 4	Cerebrovascular dementia	ICD11: 6D81	[77]
Urethane	Drug Info	Phase 4	Lung cancer	ICD11: 2C25	[78]
Zopiclone	Drug Info	Phase 4	Insomnia	ICD11: 7A00	[29]
Proguanil	Drug Info	Phase 4	Malaria	ICD11: 1F40	[79]
Glucosamine	Drug Info	Phase 4	Osteoarthritis	ICD11: FA00	[80]
Tegafur	Drug Info	Phase 4	Colon cancer	ICD11: 2B90	[81]
Thiamylal	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[82]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 8 Drugs
Selumetinib	Drug Info	Phase 3	Neurofibromatosis	ICD11: LD2D	[83]
NSC-122758	Drug Info	Phase 3	Vitamin deficiency	ICD11: 5B55	[84]
Y-100032	Drug Info	Phase 3	Multiple myeloma	ICD11: 2A83	[85]
HSDB-3466	Drug Info	Phase 3	Psoriasis vulgaris	ICD11: EA90	[86]
SC-15090	Drug Info	Phase 3	Acute bronchitis	ICD11: CA42	[87]
LY-450139	Drug Info	Phase 3	Alzheimer disease	ICD11: 8A20	[88]
SR-4233	Drug Info	Phase 3	Alzheimer disease	ICD11: 8A20	[89]
ARC-029	Drug Info	Phase 3	Alzheimer disease	ICD11: 8A20	[90]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 9 Drugs
Verapamil	Drug Info	Phase 2/3	Hypertension	ICD11: BA00-BA04	[91]
ENT-1814	Drug Info	Phase 2/3	Bell palsy	ICD11: 8B88	[23]
N-547	Drug Info	Phase 2/3	Lung cancer	ICD11: 2C25	[92]
Ethanol	Drug Info	Phase 2	Diabetic nephropathy	ICD11: GB61	[93]
Ethanol	Drug Info	Phase 2	Diabetic nephropathy	ICD11: GB61	[94]
BCP-13498	Drug Info	Phase 2	Anaesthesia	ICD11: 8E22	[95]
Vincamine	Drug Info	Phase 2	Cerebrovascular dementia	ICD11: 6D81	[96]
GTS-21	Drug Info	Phase 2	Schizophrenia	ICD11: 6A20	[97]
HSDB-1516	Drug Info	Phase 2	Allergy	ICD11: 4A80	[98]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 5 Drugs
STX 64	Drug Info	Phase 1	Prostate cancer	ICD11: 2C82	[99]
AST-1306	Drug Info	Phase 1	Solid tumour/cancer	ICD11: 2A00-2F9Z	[100]
GTPL-1666	Drug Info	Phase 1	Cerebral vasospasm	ICD11: BA85	[101]
INS-260	Drug Info	Phase 1	Colorectal cancer	ICD11: 2B91	[102]
FO-611	Drug Info	Phase 1	Hepatic encephalopathy	ICD11: DB99	[103]
Discontinued/withdrawn Drugs			Click to Show/Hide the Full List of Drugs: 4 Drugs
TAK-802	Drug Info	Discontinued in Phase 2	Urinary dysfunction	ICD11: GC2Z	[104]
BMS-181168	Drug Info	Discontinued in Phase 2	Cognitive impairment	ICD11: 6D71	[105]
EGYT-3886	Drug Info	Discontinued	Anxiety disorder	ICD11: 6B00	[106]
CAM-2028	Drug Info	Discontinued	Acute nasopharyngitis	ICD11: CA00	[80]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 11 Drugs
Benzylamine	Drug Info	Investigative	Functional nausea/vomiting	ICD11: DD90	[107]
Chloroben	Drug Info	Investigative	Discovery agent	ICD: N.A.	[108]
Coumarin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[109]
N,N-dimethylformamide	Drug Info	Investigative	Discovery agent	ICD: N.A.	[110]
Aniline	Drug Info	Investigative	Discovery agent	ICD: N.A.	[111]
Antipyrine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[112]
Chloroxylenol	Drug Info	Investigative	Pseudomonas infection	ICD11: 1G40	[23]
Lauric acid	Drug Info	Investigative	Alzheimer disease	ICD11: 8A20	[113], [114]
Paraoxon	Drug Info	Investigative	Discovery agent	ICD: N.A.	[115]
Thiram	Drug Info	Investigative	Discovery agent	ICD: N.A.	[116]
AC1L9GJA	Drug Info	Investigative	Discovery agent	ICD: N.A.	[117]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR009212	3,4-Dihydroxycinnamic Acid	3,4-Dihydroxycinnamic Acid Metabolite M	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[75]
MR009202	3-(Dihydroxyphenyl)propanoic acid	O-quinone	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[75]
MR000050	Acetaminophen	NAPQI	Oxidation - Oxidation	Acetaminophen	[118], [119]
MR008995	Almogran	N-desmethylalmotriptan	Oxidation - N-demethylation	Almogran	[8]
MR000155	Almotriptan malate	LAS 31612	Oxidation - N-Demethylation	Almotriptan malate	[13], [120]
MR012856	Aniline	4-aminophenol	Oxidation - Aromatic hydroxylation	Aniline	[121]
MR012857	Aniline	N-Hydroxyaniline	Oxidation - N-oxidation	Aniline	[122]
MR007494	Arachidonic acid	19-HETE	Other reaction - Omega-hydroxylation	Arachidonic acid	[123]
MR009785	AST-1306	Allitinib M1	Oxidation - O-dealkylation	AST-1306	[100]
MR007296	Paracetamol	N-acetil-p-benzoquinone imine	Unclear - Unclear	BCP-13498	[95]
MR008758	Benzocaine	Benzocaine hydroxylamine	Oxidation - N-hydroxylation	Benzocaine	[38]
MR007535	Benzylamine	Benzamide	Unclear - Unclear	Benzylamine	[107]
MR013779	Berberine	Demethyleneberberine	Oxidation - Demethylenation	Berberine	[124], [74]
MR000466	Bromperidol	4-fluorobenzoyl-propionic acid (FBPA)	Unclear - Unclear	Bromperidol	[125]
MR000513	Bupropion	S-hydroxybupropion	Oxidation - Hydroxylation	Bupropion	[126]
MR000513	Bupropion	R-hydroxybupropion	Oxidation - Hydroxylation	Bupropion	[126]
MR000544	Caffeine	1,3,7-Trimethyluric acid	Oxidation - 8-Hydroxylation	Caffeine	[127], [128]
MR000546	Caffeine	Theophylline	Oxidation - 7-N-Demethylation	Caffeine	[127], [128]
MR000545	Caffeine	Theobromine	Oxidation - 1-N-Demethylation	Caffeine	[127], [128]
MR002818	Capsaicin	Capsaicin metabolite M1	Oxidation - Dehydrogenation	Capsaicin	[11]
MR002819	Capsaicin	Capsaicin metabolite M2	Oxidation - Omega-Hydroxylation	Capsaicin	[11]
MR002820	Capsaicin	Capsaicin metabolite M3	Oxidation - Omega-1-Hydroxylation	Capsaicin	[11]
MR002821	Capsaicin	Capsaicin metabolite M4	Oxidation - Dehydrogenation	Capsaicin	[11]
MR002822	Capsaicin	Capsaicin metabolite M5M7	Oxidation - Hydroxylation	Capsaicin	[11]
MR002823	Capsaicin	Capsaicin metabolite M6	Oxidation - O-Dehydrogenation	Capsaicin	[11]
MR002824	Capsaicin	Capsaicin metabolite M8	Oxidation - N-Dehydrogenation; Oxygenation	Capsaicin	[11]
MR002825	Capsaicin	Capsaicin metabolite M9	Oxidation - N-Dehydrogenation	Capsaicin	[11]
MR000570	Carvedilol	4'-hydroxyphenylcarvedilol	Oxidation - 4'-Hydroxylation	Carvedilol	[129]
MR000572	Carvedilol	O-Desmethylcarvedilol	Oxidation - O-Demethylation	Carvedilol	[129]
MR006231	Chloroben	Chloroben metabolite M1	Oxidation - Oxidationn	Chloroben	[130]
MR006246	Chloroben	Chloroben metabolite M14	Oxidation - Oxidationn	Chloroben	[130]
MR006232	Chloroben metabolite M1	Chloroben metabolite M4	Oxidation - Oxidationn	Chloroben	[130]
MR006233	Chloroben metabolite M1	Chloroben metabolite M8	Oxidation - Oxidationn	Chloroben	[130]
MR006235	Chloroben metabolite M1	Chloroben metabolite M2	Oxidation - Oxidationn	Chloroben	[130]
MR006243	Chloroben metabolite M10	Chloroben metabolite M11	Oxidation - Oxidationn	Chloroben	[130]
MR006247	Chloroben metabolite M14	Chloroben metabolite M15	Oxidation - Oxidationn	Chloroben	[130]
MR006249	Chloroben metabolite M15	Chloroben metabolite M16	Oxidation - Oxidationn	Chloroben	[130]
MR006250	Chloroben metabolite M15	Chloroben metabolite M17	Oxidation - Oxidationn	Chloroben	[130]
MR006251	Chloroben metabolite M16	Chloroben metabolite M18	Oxidation - Oxidationn	Chloroben	[130]
MR006252	Chloroben metabolite M17	Chloroben metabolite M18	Oxidation - Oxidationn	Chloroben	[130]
MR006245	Chloroben metabolite M2	Chloroben metabolite M3	Oxidation - Oxidationn	Chloroben	[130]
MR006236	Chloroben metabolite M4	Chloroben metabolite M5	Oxidation - Oxidationn	Chloroben	[130]
MR006237	Chloroben metabolite M4	Chloroben metabolite M6	Oxidation - Oxidationn	Chloroben	[130]
MR006238	Chloroben metabolite M5	Chloroben metabolite M7	Oxidation - Oxidationn	Chloroben	[130]
MR006239	Chloroben metabolite M6	Chloroben metabolite M7	Oxidation - Oxidationn	Chloroben	[130]
MR006240	Chloroben metabolite M8	Chloroben metabolite M9	Oxidation - Oxidationn	Chloroben	[130]
MR006241	Chloroben metabolite M8	Chloroben metabolite M10	Oxidation - Oxidationn	Chloroben	[130]
MR006242	Chloroben metabolite M9	Chloroben metabolite M11	Oxidation - Oxidationn	Chloroben	[130]
MR006255	Chloroxylenol	Unclear	Unclear - Unclear	Chloroxylenol	[23]
MR000651	Chlorzoxazone	6-hydroxychlorzoxazone	Oxidation - 6-Hydroxylation	Chlorzoxazone	[131], [132], [133]
MR005306	Coumarin	Coumarin 3,4-epoxide	Oxidation - Epoxidation	Coumarin	[109]
MR006605	Dacarbazine	5-[3-hydroxymethyl-3-methyl-triazen-1-yl]-imidazole-4-carboxamide (HMMTIC)	Unclear - Unclear	Dacarbazine	[134]
MR000717	Dalfampridine	3-hydroxy-4-aminopyridine	Unclear - Unclear	Dalfampridine	[135]
MR000718	Dalfampridine	3-hydroxy-4-aminopyridine sulfate metabolite	Unclear - Unclear	Dalfampridine	[135]
MR000733	Dapsone	Dapsone hydroxylamine	Oxidation - N-Hydroxylation	Dapsone	[1]
MR003252	Delamanid	(4RS,5S)-DM-6720	Unclear - Unclear	Delamanid	[136]
MR000883	Diethyldithiocarbamic acid methyl ester	.	Oxidation - Thiono-Oxidation	Disulfiram	[137]
MR006651	Dorzolamide hydrochloride	N-desethyldorzolamide	Oxidation - N-deethylation	Dorzolamide hydrochloride	[138], [61]
MR006870	Enflurane	2-(Difluoromethoxy)-2,2-difluoroacetyl fluoride	Reduction - Dehalogenation	Enflurane	[139], [140], [141]
MR006051	ENT-1814	Hydroquinone	Oxidation - Aromatic hydroxylation	ENT-1814	[142]
MR002711	Eszopiclone	Zopiclone N-oxide	Oxidation - N-Oxidation	Eszopiclone	[143]
MR007449	Ethanol	Acetaldehyde	Oxidation - Oxidationn	Ethanol	[94]
MR007449	Ethanol	Acetaldehyde	Unclear - Unclear	Ethanol	[93], [94]
MR002730	Ethosuximide	2-(2-hydroxyethyl)-2-methylsuccinimide	Oxidation - Hydroxylation	Ethosuximide	[144], [30], [145]
MR002731	Ethosuximide	2-(1-hydroxyethyl)-2-methylsuccinimide	Oxidation - Hydroxylation	Ethosuximide	[144], [30], [146]
MR002732	Ethosuximide	2-ethyl-3-hydroxy-2-methylsuccinimide	Oxidation - Hydroxylation	Ethosuximide	[144], [30], [145]
MR002733	Ethosuximide	2-ethyl-2-hydroxymethyl succinimide	Oxidation - Hydroxylation	Ethosuximide	[144]
MR001019	Felbamate	p-hydroxyfelbamate	Unclear - Unclear	Felbamate	[147]
MR001020	Felbamate	2-hydroxyfelbamate	Oxidation - Oxidation	Felbamate	[148]
MR001085	Fomepizole	4-carboxypyrazole	Unclear - Unclear	Fomepizole	[149], [50]
MR003260	Propofol	4-hydroxymethylpyrazole	Unclear - Unclear	Fospropofol	[150]
MR001098	Furosemide	4-chloro-5-sulfamoylanthranilic acid	Oxidation - N-Dealkylation	Furosemide	[151]
MR005974	GTPL-463	4-carboxypyrazole	Unclear - Unclear	GTPL-463	[50]
MR005814	GTS-21	2-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[97]
MR005812	GTS-21	4-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[97]
MR005812	GTS-21	4-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[97]
MR005814	GTS-21	2-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[97]
MR005085	Halothane	Trifluoroacetyl chloride	Reduction - Dehalogenation	Halothane	[111]
MR005081	Halothane	Bromide	Oxidation - Oxidationn	Halothane	[152]
MR005082	Halothane	Trifluoroacetic acid	Oxidation - Oxidationn	Halothane	[152]
MR004661	Chloroacetaldehyde	2-chloroethanol	Oxidation - Oxidationn	Ifosfamide	[12]
MR011241	N-desacetylIndiplon	N-desmethyl-desacetyl-Indiplon	Oxidation - N-demethylation	indiplon	[153]
MR001231	Isoflurane	Trifluoroacetic acid	Unclear - Unclear	Isoflurane	[65]
MR001233	Acetylisoniazid	Isonicotinic acid	Unclear - Unclear	Isoniazid	[154]
MR001238	Hydrazine	Isoniazid reactive metabolite	Unclear - Unclear	Isoniazid	[154]
MR005371	Lauric acid	11-hydroxylauric acid	Oxidation - Hydrolyzationn	Lauric acid	[114]
MR005368	Lauric acid	12-Hydroxydodecanoic Acid	Oxidation - Aliphatic hydroxylation	Lauric acid	[113], [114]
MR006906	Lorcaserin	N-hydroxylorcaserin	Oxidation - Hydrolyzationn	Lorcaserin	[21]
MR003762	LY-450139	LY-2484595 Metabolite M3	Oxidation - Benzylic hydroxylation	LY-450139	[88]
MR002857	Meloxicam	5-hydroxymethyl meloxicam	Oxidation - Hydroxylation	Meloxicam	[155], [66]
MR001650	17alpha-Ethinylestradiol	Ethinylestradiol-3-sulfate	Conjugation - Sulfation	Mestranol	[156]
MR006062	N-547	Nicotinamide N-oxide	Oxidation - N-oxidation	N-547	[157]
MR001730	Nicardipine hydrochloride	Dehydronicardipine	Oxidation - Heteroring Dehydrogenation	Nicardipine hydrochloride	[111], [23], [158]
MR003547	Nintedanib esylate	Nintedanib metabolite M13	Unclear - Unclear	Nintedanib esylate	[159]
MR001851	Osimertinib	AZ5104	Unclear - Unclear	Osimertinib	[160], [161], [162]
MR001852	Osimertinib	AZ7550	Unclear - Unclear	Osimertinib	[160], [161], [162]
MR001974	Pentobarbital	4-hydroxyphenobarbital	Oxidation - Hydroxylation	Pentobarbital	[163]
MR002014	Acetaminophen	NAPQI	Oxidation - Oxidation	Phenacetin	[164]
MR002023	Phenobarbital	4-hydroxyphenobarbital	Oxidation - 4-Hydroxylation	Phenobarbital	[1]
MR002024	Phenobarbital	Mephobarbital	Conjugation - Methylation	Phenobarbital	[165]
MR002036	Phenytoin	Phenytoin dihydrodiol	Oxidation - Dihydroxylation; Oxidation	Phenytoin	[1]
MR002149	Primidone	Phenylethylmalonamide (PEMA)	Unclear - Unclear	Primidone	[166], [167]
MR002150	Primidone	Phenobarbital	Unclear - Unclear	Primidone	[166], [167], [168], [169]
MR008674	Ripretinib	DP-5439	Unclear - Unclear	Ripretinib	[170]
MR006447	SC-15090	7-MX	Oxidation - N7-demethylation	SC-15090	[87]
MR002244	Desmethylsertraline	Alpha-hydroxy sertraline ketone	Oxidation - N-Hydroxylation	Sertraline hydrochloride	[171]
MR003176	Sevoflurane	Hexafluoroisopropanol	Unclear - Unclear	Sevoflurane	[172]
MR002252	Sildenafil citrate	Desmethylsildenafil	Oxidation - N-Demethylation	Sildenafil citrate	[173], [174], [56]
MR002253	Sildenafil citrate	N-dealkyl Sildenafil	Oxidation - N-Dealkylation	Sildenafil citrate	[1]
MR006465	SR-4233	Tirapazamine radical	Unclear - Unclear	SR-4233	[89]
MR009357	TAK-802 Metabolite M-IV	TAK-802 Metabolite M-II	Unclear - Unclear	TAK-802	[104]
MR005270	5'-hydroxytegafur	Fluorouracil	Other reaction - Degradation	Tegafur	[23], [81]
MR004939	Thalidomide	Thalidomide arene oxide	Oxidation - Epoxidation	Thalidomide	[1], [175]
MR004947	Theophylline	1,3-dimethyluric acid	Oxidation - 8-hydroxylation	Theophylline	[70]
MR006174	Thiamylal	Thiamylal carboxylic acid	Oxidation - Oxidationn	Thiamylal	[176], [177]
MR002911	Trimethadione	Dimethadione	Oxidation - N-Demethylation	Trimethadione	[178], [69]
MR006225	Urethane	Carbon dioxide	Unclear - Unclear	Urethane	[78]
MR006227	Urethane	Vinyl carbamate	Unclear - Unclear	Urethane	[179]
MR006498	Y-100032	Unclear	Unclear - Unclear	Y-100032	[85]


⏷ Show the Full List of 119 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.18E-01; Fold-change: 5.90E-02; Z-score: 1.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.39E-01; Fold-change: -1.08E-02; Z-score: -1.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.03E-03; Fold-change: -1.91E-01; Z-score: -1.01E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.45E-02; Fold-change: -7.38E-02; Z-score: -3.22E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-01; Fold-change: -5.80E-02; Z-score: -5.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.58E-01; Fold-change: 1.31E-01; Z-score: 2.57E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.57E-01; Fold-change: -3.65E-02; Z-score: -1.83E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.49E-94; Fold-change: -7.35E-01; Z-score: -1.60E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.47E-01; Fold-change: -2.42E-01; Z-score: -5.76E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.48E-01; Fold-change: 3.53E-02; Z-score: 1.86E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.84E-07; Fold-change: -6.21E-01; Z-score: -3.73E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-01; Fold-change: 6.68E-02; Z-score: 4.47E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.35E-02; Fold-change: 7.86E-02; Z-score: 5.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.92E-03; Fold-change: 1.81E-02; Z-score: 1.34E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.88E-02; Fold-change: 6.84E-02; Z-score: 6.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.54E-01; Fold-change: -1.25E-01; Z-score: -2.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.05E-01; Fold-change: -5.50E-02; Z-score: -7.63E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.00E-06; Fold-change: 1.50E-01; Z-score: 3.20E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.94E-06; Fold-change: 7.00E-02; Z-score: 4.44E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.75E-04; Fold-change: -4.29E-01; Z-score: -9.27E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.10E-06; Fold-change: -4.51E-01; Z-score: -8.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.40E-02; Fold-change: -1.74E+00; Z-score: -1.91E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.80E-01; Fold-change: -2.76E-01; Z-score: -6.46E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.16E-01; Fold-change: -2.77E-02; Z-score: -9.84E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.90E-01; Fold-change: -7.63E-02; Z-score: -4.17E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.42E-01; Fold-change: -1.05E-01; Z-score: -5.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-01; Fold-change: -1.33E-01; Z-score: -1.06E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.79E-02; Fold-change: -2.42E-01; Z-score: -1.32E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.21E-01; Fold-change: -4.74E-01; Z-score: -8.77E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.72E-02; Fold-change: -5.76E-01; Z-score: -7.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.39E-47; Fold-change: -1.57E+00; Z-score: -4.16E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.97E-42; Fold-change: -1.41E+00; Z-score: -2.10E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 6.58E-53; Fold-change: -1.65E+00; Z-score: -2.83E+01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.89E-08; Fold-change: 1.30E-02; Z-score: 8.86E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.45E-01; Fold-change: -7.00E-02; Z-score: -4.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.62E-03; Fold-change: -1.23E+00; Z-score: -1.11E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.22E-57; Fold-change: -1.11E+00; Z-score: -1.79E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.49E-69; Fold-change: -1.75E+00; Z-score: -2.33E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.91E-13; Fold-change: 6.46E-02; Z-score: 3.30E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.13E-01; Fold-change: 3.66E-02; Z-score: 8.92E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.79E-01; Fold-change: -8.17E-02; Z-score: -6.97E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.02E-01; Fold-change: 8.84E-03; Z-score: 2.07E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.26E-01; Fold-change: -5.53E-02; Z-score: -1.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.23E-02; Fold-change: -4.31E-02; Z-score: -1.51E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.89E-01; Fold-change: -3.50E-01; Z-score: -1.06E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.17E-01; Fold-change: 1.32E-01; Z-score: 3.15E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.32E-02; Fold-change: -4.14E-01; Z-score: -8.77E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.28E-04; Fold-change: -1.99E-01; Z-score: -2.73E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.16E-01; Fold-change: 1.52E-02; Z-score: 1.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.05E-02; Fold-change: 2.24E-01; Z-score: 7.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.71E-04; Fold-change: -7.97E-01; Z-score: -2.83E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.92E-10; Fold-change: 9.21E-02; Z-score: 5.56E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.25E-01; Fold-change: 7.57E-03; Z-score: 4.97E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 7.30E-01; Fold-change: -7.79E-02; Z-score: -5.92E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.81E-04; Fold-change: 3.83E-01; Z-score: 2.11E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.01E-04; Fold-change: 3.85E-01; Z-score: 1.98E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.00E-04; Fold-change: -1.73E-01; Z-score: -1.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.47E-01; Fold-change: 2.86E-02; Z-score: 1.47E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.80E-01; Fold-change: 3.68E-03; Z-score: 3.41E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.45E-01; Fold-change: 5.71E-02; Z-score: 4.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.57E-01; Fold-change: 3.09E-01; Z-score: 6.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.78E-02; Fold-change: -8.42E-02; Z-score: -4.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.35E-07; Fold-change: -1.38E-01; Z-score: -4.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.30E-02; Fold-change: 1.39E-01; Z-score: 1.09E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.21E-01; Fold-change: 5.69E-03; Z-score: 1.17E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.10E-02; Fold-change: -2.05E-01; Z-score: -6.81E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.63E-01; Fold-change: -4.80E-02; Z-score: -2.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.41E-01; Fold-change: 1.29E-03; Z-score: 1.14E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.89E-02; Fold-change: 6.41E-02; Z-score: 6.54E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.66E-01; Fold-change: 1.02E-01; Z-score: 8.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.40E-01; Fold-change: -1.36E-01; Z-score: -7.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.42E-01; Fold-change: 4.17E-02; Z-score: 7.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.99E-01; Fold-change: 1.42E-01; Z-score: 7.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.39E-01; Fold-change: 6.30E-02; Z-score: 4.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.03E-01; Fold-change: -6.60E-02; Z-score: -4.09E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.43E-01; Fold-change: 1.27E-02; Z-score: 5.63E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.20E-02; Fold-change: -1.71E-01; Z-score: -3.15E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.07E-01; Fold-change: -2.23E-02; Z-score: -1.46E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.85E-01; Fold-change: -6.88E-02; Z-score: -1.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.11E-01; Fold-change: -4.77E-02; Z-score: -2.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.06E-01; Fold-change: -5.05E-02; Z-score: -1.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.45E-02; Fold-change: -1.86E-01; Z-score: -9.83E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.81E-02; Fold-change: 1.10E-01; Z-score: 1.38E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.87E-04; Fold-change: -1.20E-01; Z-score: -3.22E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.67E-02; Fold-change: -1.16E-01; Z-score: -5.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.75E-01; Fold-change: -1.76E-01; Z-score: -6.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.13E-01; Fold-change: -1.05E-01; Z-score: -5.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 5.73E-01; Fold-change: 1.25E-01; Z-score: 6.28E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.09E-01; Fold-change: 3.19E-02; Z-score: 2.34E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.77E-02; Fold-change: 2.60E-01; Z-score: 1.25E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-02; Fold-change: -1.94E-01; Z-score: -4.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.81E-01; Fold-change: 6.10E-02; Z-score: 4.21E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.68E-01; Fold-change: 6.40E-02; Z-score: 1.83E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-02; Fold-change: -3.26E-01; Z-score: -1.59E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.47E-02; Fold-change: -1.23E-01; Z-score: -8.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.22E-03; Fold-change: -3.12E-01; Z-score: -1.39E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.61E-01; Fold-change: 9.52E-03; Z-score: 1.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.66E-04; Fold-change: -1.04E+00; Z-score: -7.59E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.63E-01; Fold-change: -3.68E-02; Z-score: -3.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.13E-01; Fold-change: 2.68E-01; Z-score: 5.32E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.79E-02; Fold-change: 4.92E-01; Z-score: 1.27E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.71E-01; Fold-change: 2.46E-02; Z-score: 1.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.73E-01; Fold-change: -1.48E-02; Z-score: -1.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.08E-01; Fold-change: 3.02E-02; Z-score: 1.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.24E-01; Fold-change: -8.81E-03; Z-score: -4.67E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.10E-04; Fold-change: 1.44E-01; Z-score: 2.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.20E-01; Fold-change: 3.19E-02; Z-score: 1.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.58E-01; Fold-change: 4.81E-02; Z-score: 9.30E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.62E-02; Fold-change: 9.64E-01; Z-score: 4.21E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.39E-01; Fold-change: 9.57E-02; Z-score: 2.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.45E-02; Fold-change: -4.32E+00; Z-score: -9.91E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.97E-01; Fold-change: -1.39E-02; Z-score: -4.20E-02
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.24E-01; Fold-change: 3.23E-02; Z-score: 1.59E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.85E-01; Fold-change: 6.79E-02; Z-score: 1.57E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.05E-32; Fold-change: 1.42E+00; Z-score: 2.27E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.68E-03; Fold-change: 3.70E-01; Z-score: 6.32E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.98E-01; Fold-change: 9.63E-02; Z-score: 1.38E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.19E-05; Fold-change: 4.85E-01; Z-score: 1.06E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.49E-01; Fold-change: 3.07E-01; Z-score: 7.84E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.65E-01; Fold-change: 1.91E-02; Z-score: 1.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.40E-01; Fold-change: 2.81E-02; Z-score: 1.36E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.59E-01; Fold-change: 2.47E-02; Z-score: 1.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.69E-01; Fold-change: 6.50E-02; Z-score: 1.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.53E-10; Fold-change: -2.24E-01; Z-score: -9.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.60E-01; Fold-change: -2.35E-03; Z-score: -2.74E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.24E-01; Fold-change: -9.91E-02; Z-score: -3.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.20E-01; Fold-change: 3.70E-02; Z-score: 1.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.09E-02; Fold-change: 1.49E-01; Z-score: 9.86E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.12E-01; Fold-change: -6.02E-02; Z-score: -3.95E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.00E-01; Fold-change: 3.44E-02; Z-score: 3.24E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.64E-02; Fold-change: -5.71E-01; Z-score: -1.32E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
2	Validation of bupropion hydroxylation as a selective marker of human cytochrome P450 2B6 catalytic activity. Drug Metab Dispos. 2000 Oct;28(10):1222-30.
3	Genotoxicity of tamoxifen, tamoxifen epoxide and toremifene in human lymphoblastoid cells containing human cytochrome P450s. Carcinogenesis. 1994 Jan;15(1):5-9.
4	Metabolism and pharmacokinetics of novel selective vascular endothelial growth factor receptor-2 inhibitor apatinib in humans
5	Novel metabolic pathway of estrone and 17beta-estradiol catalyzed by cytochrome P-450. Drug Metab Dispos. 2000 Feb;28(2):110-2.
6	Effects of nicotine on cytochrome P450 2A6 and 2E1 activities. Br J Clin Pharmacol. 2010 Feb;69(2):152-9.
7	Metabolic Profiles of Propofol and Fospropofol: Clinical and Forensic Interpretative Aspects
8	DrugBank(Pharmacology-Metabolism):Almogran
9	U. S. FDA Label -Almogran
10	Cytochrome P450-Catalyzed Metabolism of Cannabidiol to the Active Metabolite 7-Hydroxy-Cannabidiol Drug Metab Dispos. 2021 Oct;49(10):882-891. doi: 10.1124/dmd.120.000350.
11	Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
12	DrugBank(Pharmacology-Metabolism):Ifosfamide
13	Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
14	Identification of the human P-450 enzymes responsible for the sulfoxidation and thiono-oxidation of diethyldithiocarbamate methyl ester: role of P-450 enzymes in disulfiram bioactivation Alcohol Clin Exp Res. 1998 Sep;22(6):1212-9.
15	Inhibition of CYP2E1 catalytic activity in vitro by S-adenosyl-L-methionine. Biochem Pharmacol. 2005 Apr 1;69(7):1081-93.
16	In vitro characterization of the human biotransformation and CYP reaction phenotype of ET-743 (Yondelis, Trabectidin), a novel marine anti-cancer drug. Invest New Drugs. 2006 Jan;24(1):3-14.
17	Antidepressant drugs in the elderly--role of the cytochrome P450 2D6. World J Biol Psychiatry. 2003 Apr;4(2):74-80.
18	Concordance between trifluoroacetic acid and hepatic protein trifluoroacetylation after disulfiram inhibition of halothane metabolism in rats. Acta Anaesthesiol Scand. 2003 Jul;47(6):765-70.
19	CYP2E1 active site residues in substrate recognition sequence 5 identified by photoaffinity labeling and homology modeling. Arch Biochem Biophys. 2007 Mar 1;459(1):59-69.
20	In vitro identification of the human cytochrome P450 enzymes involved in the metabolism of R(+)- and S(-)-carvedilol. Drug Metab Dispos. 1997 Aug;25(8):970-7.
21	Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
22	Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of dolasetron. Comparison with other indole-containing 5-HT3 antagonists. Drug Metab Dispos. 1996 May;24(5):602-9.
23	Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
24	Five distinct human cytochromes mediate amitriptyline N-demethylation in vitro: dominance of CYP 2C19 and 3A4. J Clin Pharmacol. 1998 Feb;38(2):112-21.
25	FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
26	Metabolic stability and determination of cytochrome P450 isoenzymes' contribution to the metabolism of medetomidine in dog liver microsomes. Biomed Chromatogr. 2010 Aug;24(8):868-77.
27	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
28	In vitro metabolism of quinidine: the (3S)-3-hydroxylation of quinidine is a specific marker reaction for cytochrome P-4503A4 activity in human liver microsomes. J Pharmacol Exp Ther. 1999 Apr;289(1):31-7.
29	Eszopiclone, a nonbenzodiazepine sedative-hypnotic agent for the treatment of transient and chronic insomnia. Clin Ther. 2006 Apr;28(4):491-516.
30	Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes. Xenobiotica. 2003 Mar;33(3):265-76.
31	CYP4F enzymes are responsible for the elimination of fingolimod (FTY720), a novel treatment of relapsing multiple sclerosis. Drug Metab Dispos. 2011 Feb;39(2):191-8.
32	Modulation of ethanol-mediated CYP2E1 induction by clofibrate and L-carnitine in rat liver. Biol Pharm Bull. 1993 Dec;16(12):1240-3.
33	CYP2C19 polymorphism effect on phenobarbitone. Pharmacokinetics in Japanese patients with epilepsy: analysis by population pharmacokinetics Eur J Clin Pharmacol. 2000 Feb-Mar;55(11-12):821-5. doi: 10.1007/s002280050703.
34	Inhibition of cytochrome P450 2E1 by propofol in human and porcine liver microsomes. Biochem Pharmacol. 2002 Oct 1;64(7):1151-6.
35	Construction and assessment of models of CYP2E1: predictions of metabolism from docking, molecular dynamics, and density functional theoretical calculations. J Med Chem. 2003 Apr 24;46(9):1645-60.
36	Effect of disulfiram-mediated CYP2E1 inhibition on the disposition of vesnarinone
37	Acetaminophen induced acute liver failure via oxidative stress and JNK activation: protective role of taurine by the suppression of cytochrome P450 2E1. Free Radic Res. 2010 Mar;44(3):340-55.
38	More methemoglobin is produced by benzocaine treatment than lidocaine treatment in human in vitro systems
39	Cytochrome P450 2E1 null mice provide novel protection against cisplatin-induced nephrotoxicity and apoptosis. Kidney Int. 2003 May;63(5):1687-96.
40	A study on the metabolism of etoposide and possible interactions with antitumor or supporting agents by human liver microsomes. J Pharmacol Exp Ther. 1998 Sep;286(3):1294-300.
41	N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
42	Role of specific cytochrome P450 enzymes in the N-oxidation of the antiarrhythmic agent mexiletine. Xenobiotica. 2003 Jan;33(1):13-25.
43	Effects of olopatadine, a new antiallergic agent, on human liver microsomal cytochrome P450 activities Drug Metab Dispos. 2002 Dec;30(12):1504-11. doi: 10.1124/dmd.30.12.1504.
44	Phenobarbital induces monkey brain CYP2E1 protein but not hepatic CYP2E1, in vitro or in vivo chlorzoxazone metabolism. Eur J Pharmacol. 2006 Dec 15;552(1-3):151-8.
45	Drug Interactions with Angiotensin Receptor Blockers: Role of Human Cytochromes P450
46	Lithium Intoxication in the Elderly: A Possible Interaction between Azilsartan, Fluvoxamine, and Lithium
47	Dalfampridine: a medication to improve walking in patients with multiple sclerosis. Ann Pharmacother. 2012 Jul-Aug;46(7-8):1010-5.
48	CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
49	Chronic ethanol feeding and folate deficiency activate hepatic endoplasmic reticulum stress pathway in micropigs. Am J Physiol Gastrointest Liver Physiol. 2005 Jul;289(1):G54-63.
50	Treatment of patients with ethylene glycol or methanol poisoning: focus on fomepizole. Open Access Emerg Med. 2010 Aug 24;2:67-75.
51	Effects of cytochrome P450 inducers and inhibitors on the pharmacokinetics of intravenous furosemide in rats: involvement of CYP2C11, 2E1, 3A1 and 3A2 in furosemide metabolism. J Pharm Pharmacol. 2009 Jan;61(1):47-54.
52	FDA label of Mitoxantrone. The 2020 official website of the U.S. Food and Drug Administration.
53	The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46.
54	Clinically significant pharmacokinetic drug interactions between antiepileptic drugs. J Clin Pharm Ther. 1999 Apr;24(2):87-92.
55	PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA166181117)
56	Erectile dysfunction drugs changed the protein expressions and activities of drug-metabolising enzymes in the liver of male rats. Oxid Med Cell Longev. 2016;2016:4970906.
57	The metabolic rate constants and specific activity of human and rat hepatic cytochrome P-450 2E1 toward toluene and chloroform. J Toxicol Environ Health A. 2004 Apr 9;67(7):537-53.
58	Prediction of human liver microsomal oxidations of 7-ethoxycoumarin and chlorzoxazone with kinetic parameters of recombinant cytochrome P-450 enzymes. Drug Metab Dispos. 1999 Nov;27(11):1274-80.
59	Human cytochrome p450 induction and inhibition potential of clevidipine and its primary metabolite h152/81. Drug Metab Dispos. 2006 May;34(5):734-7.
60	Role of cytochrome P450 isoenzymes in metabolism of O(6)-benzylguanine: implications for dacarbazine activation. Clin Cancer Res. 2001 Dec;7(12):4239-44.
61	In vitro metabolism of dorzolamide, a novel potent carbonic anhydrase inhibitor, in rat liver microsomes. Drug Metab Dispos. 1994 Nov-Dec;22(6):916-21.
62	Stereoselective metabolism of enflurane by human liver cytochrome P450 2E1. Drug Metab Dispos. 1995 Dec;23(12):1426-30.
63	Pharmacokinetics, pharmacodynamics and drug interaction potential of enfuvirtide. Clin Pharmacokinet. 2005;44(2):175-86.
64	Cross-species comparisons of the pharmacokinetics of ibudilast
65	Clinical isoflurane metabolism by cytochrome P450 2E1. Anesthesiology. 1999 Mar;90(3):766-71.
66	Metabolism of Meloxicam in human liver involves cytochromes P4502C9 and 3A4. Xenobiotica. 1998 Jan;28(1):1-13.
67	Protective effect of rifampicin against acute liver injury induced by carbon tetrachloride in mice. Jpn J Pharmacol. 1995 Dec;69(4):325-34.
68	DrugBank(Pharmacology-Metabolism):Ripretinib
69	Involvement of cytochrome P450 2C9, 2E1 and 3A4 in trimethadione N-demethylation in human microsomes. J Clin Pharm Ther. 2003 Dec;28(6):493-6.
70	Theophylline metabolism in human liver microsomes: inhibition studies. J Pharmacol Exp Ther. 1996 Mar;276(3):912-7.
71	CYP2E1 overexpression alters hepatocyte death from menadione and fatty acids by activation of ERK1/2 signaling. Hepatology. 2004 Feb;39(2):444-55.
72	Mechanisms of circadian rhythmicity of carbon tetrachloride hepatotoxicity. J Pharmacol Exp Ther. 2002 Jan;300(1):273-81.
73	Delta-9-Tetrahydrocannabinol and Cannabidiol Drug-Drug Interactions
74	CYP2D plays a major role in berberine metabolism in liver of mice and humans
75	Metabolism of caffeic acid by isolated rat hepatocytes and subcellular fractions
76	Involvement of CYP2E1 as A low-affinity enzyme in phenacetin O-deethylation in human liver microsomes. Drug Metab Dispos. 1999 Aug;27(8):860-5.
77	Effects of phenothiazine neuroleptics on the rate of caffeine demethylation and hydroxylation in the rat liver. Pol J Pharmacol. 2001 Nov-Dec;53(6):615-21.
78	Cytochrome P450 2E1 (CYP2E1) is the principal enzyme responsible for urethane metabolism: comparative studies using CYP2E1-null and wild-type mice
79	Comparison of (S)-mephenytoin and proguanil oxidation in vitro: contribution of several CYP isoforms. Br J Clin Pharmacol. 1999 Aug;48(2):158-67.
80	Characterization of moclobemide N-oxidation in human liver microsomes. Xenobiotica. 2001 Jul;31(7):387-97.
81	Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
82	Effects of premedication medicines on the formation of the CYP3A4-dependent metabolite of ropivacaine, 2', 6'-Pipecoloxylidide, on human liver microsomes in vitro. Basic Clin Pharmacol Toxicol. 2006 Feb;98(2):181-3.
83	Physiologically Based Pharmacokinetic Modeling for Selumetinib to Evaluate Drug-Drug Interactions and Pediatric Dose Regimens
84	The role of inflammatory cells and cytochrome P450 in the potentiation of CCl4-induced liver injury by a single dose of retinol. Toxicol Appl Pharmacol. 1996 Dec;141(2):507-19.
85	In vitro characterization of the human biotransformation pathways of aplidine, a novel marine anti-cancer drug. Invest New Drugs. 2007 Feb;25(1):9-19.
86	Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
87	Cytochrome P450 isoform selectivity in human hepatic theobromine metabolism. Br J Clin Pharmacol. 1999 Mar;47(3):299-305.
88	Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
89	Molecular mechanisms of tirapazamine (SR 4233, Win 59075)-induced hepatocyte toxicity under low oxygen concentrations. Br J Cancer. 1995 Apr;71(4):780-5.
90	Effect of nilvadipine, a dihydropyridine calcium antagonist, on cytochrome P450 activities in human hepatic microsomes. Biol Pharm Bull. 2004 Mar;27(3):415-7.
91	DrugBank(Pharmacology-Metabolism):Verapamil
92	Nicotinamide N-oxidation by CYP2E1 in human liver microsomes. Drug Metab Dispos. 2013 Mar;41(3):550-3.
93	CYP2E1 and clinical features in alcoholics. Neuropsychobiology. 2003;47(2):86-9.
94	Ethanol Metabolism in the Liver, the Induction of Oxidant Stress, and the Antioxidant Defense System
95	Involvement of human cytochrome P450 2D6 in the bioactivation of acetaminophen. Drug Metab Dispos. 2000 Dec;28(12):1397-400.
96	Characterization of human cytochrome P450 isoenzymes involved in the metabolism of vinorelbine. Fundam Clin Pharmacol. 2005 Oct;19(5):545-53.
97	Metabolism and disposition of GTS-21, a novel drug for Alzheimer's disease. Xenobiotica. 1999 Jul;29(7):747-62.
98	Pyrethroids: mammalian metabolism and toxicity. J Agric Food Chem. 2011 Apr 13;59(7):2786-91.
99	In vitro metabolism of irosustat, a novel steroid sulfatase inhibitor: interspecies comparison, metabolite identification, and metabolic enzyme identification
100	Metabolism and pharmacokinetics of allitinib in cancer patients: the roles of cytochrome P450s and epoxide hydrolase in its biotransformation
101	Evaluation of the transport, in vitro metabolism and pharmacokinetics of Salvinorin A, a potent hallucinogen. Eur J Pharm Biopharm. 2009 Jun;72(2):471-7.
102	Kinetics of cytochrome P450 2E1-catalyzed oxidation of ethanol to acetic acid via acetaldehyde. J Biol Chem. 1999 Aug 20;274(34):23833-40.
103	CYP2E1--biochemical and toxicological aspects and role in alcohol-induced liver injury. Mt Sinai J Med. 2006 Jul;73(4):657-72.
104	Main metabolic pathways of TAK-802, a novel drug candidate for voiding dysfunction, in humans: the involvement of carbonyl reduction by 11-hydroxysteroid dehydrogenase 1
105	Behavior of thymidylate kinase toward monophosphate metabolites and its role in the metabolism of 1-(2'-deoxy-2'-fluoro-beta-L-arabinofuranosyl)-5-methyluracil (Clevudine) and 2',3'-didehydro-2',3'-dideoxythymidine in cells. Antimicrob Agents Chemother. 2005 May;49(5):2044-9. doi: 10.1128/AAC.49.5.2044-2049.2005.
106	Role of CYP2E1 in deramciclane metabolism. Drug Metab Dispos. 2005 Nov;33(11):1717-22.
107	Bioactivation of benzylamine to reactive intermediates in rodents: formation of glutathione, glutamate, and peptide conjugates
108	Cytochrome P450 catalyzed oxidation of monochlorobenzene, 1,2- and 1,4-dichlorobenzene in rat, mouse, and human liver microsomes. Chem Biol Interact. 1998 Aug 14;115(1):53-70.
109	Identification of the cytochromes P450 that catalyze coumarin 3,4-epoxidation and 3-hydroxylation
110	Association between CYP2E1 and GOT2 gene polymorphisms and susceptibility and low-dose N,N-dimethylformamide occupational exposure-induced liver injury. Int Arch Occup Environ Health. 2019 Oct;92(7):967-975.
111	Cytochromes P450: a structure-based summary of biotransformations using representative substrates Drug Metab Rev. 2008;40(1):1-100. doi: 10.1080/03602530802309742.
112	Identification of the human hepatic cytochromes P450 involved in the in vitro oxidation of antipyrine. Drug Metab Dispos. 1996 Apr;24(4):487-94.
113	The omega-hydroxlyation of lauric acid: oxidation of 12-hydroxlauric acid to dodecanedioic acid by a purified recombinant fusion protein containing P450 4A1 and NADPH-P450 reductase
114	Cytochrome P450 4A11 inhibition assays based on characterization of lauric acid metabolites
115	Interaction of ethanol and the organophosphorus insecticide parathion. Biochem Pharmacol. 1995 Nov 27;50(11):1925-32.
116	Effect of cytochrome P450 inducers on the metabolism and toxicity of thiram in rats. Vet Hum Toxicol. 2002 Dec;44(6):331-3.
117	Drug Interactions Flockhart Table
118	Acetaminophen, via its reactive metabolite N-acetyl-p-benzo-quinoneimine and transient receptor potential ankyrin-1 stimulation, causes neurogenic inflammation in the airways and other tissues in rodents FASEB J. 2010 Dec;24(12):4904-16. doi: 10.1096/fj.10-162438.
119	Rapid detection and quantification of paracetamol and its major metabolites using surface enhanced Raman scattering. Analyst. 2023 Apr 11;148(8):1805-1814. doi: 10.1039/d3an00249g.
120	Clinical pharmacokinetics of almotriptan, a serotonin 5-HT(1B/1D) receptor agonist for the treatment of migraine. Clin Pharmacokinet. 2005;44(3):237-46.
121	Aniline and its metabolites generate free radicals in yeast
122	Aniline derivative-induced methemoglobin in rats
123	Role of cytochrome P450 enzymes in the bioactivation of polyunsaturated fatty acids. Biochim Biophys Acta. 2011 Jan;1814(1):210-22.
124	The metabolism of berberine and its contribution to the pharmacological effects
125	Role of CYP3A in bromperidol metabolism in rat in vitro and in vivo Xenobiotica. 1999 Aug;29(8):839-46. doi: 10.1080/004982599238281.
126	DrugBank(Pharmacology-Metabolism)Bupropion
127	PharmGKB summary: caffeine pathway. Pharmacogenet Genomics. 2012 May;22(5):389-95.
128	Urine caffeine metabolites are positively associated with cognitive performance in older adults: An analysis of US National Health and Nutrition Examination Survey (NHANES) 2011 to 2014. Nutr Res. 2023 Jan;109:12-25. doi: 10.1016/j.nutres.2022.11.002.
129	Metabolism of carvedilol in dogs, rats, and mice Drug Metab Dispos. 1998 Oct;26(10):958-69.
130	Dose-dependent kinetics and metabolism of 1,2-dichlorobenzene in rat: effect of pretreatment with phenobarbital
131	Robustness of chlorzoxazone as an in vivo measure of cytochrome P450 2E1 activity Br J Clin Pharmacol. 2004 Aug;58(2):190-200. doi: 10.1111/j.1365-2125.2004.02132.x.
132	Amalgamation of in-silico, in-vitro and in-vivo approach to establish glabridin as a potential CYP2E1 inhibitor. Xenobiotica. 2021 Jun;51(6):625-635. doi: 10.1080/00498254.2021.1883769.
133	Generation and Characterization of CYP2E1-Overexpressing HepG2 Cells to Study the Role of CYP2E1 in Hepatic Hypoxia-Reoxygenation Injury. Int J Mol Sci. 2023 May 1;24(9):8121. doi: 10.3390/ijms24098121.
134	Pharmacokinetics of dacarbazine (DTIC) in pregnancy
135	LABEL:ALFAMPRIDINE tablet, extended release
136	Pharmacokinetics and metabolism of delamanid, a novel anti-tuberculosis drug, in animals and humans: importance of albumin metabolism in vivo. Drug Metab Dispos. 2015 Aug;43(8):1267-76.
137	Identification of the human P-450 enzymes responsible for the sulfoxidation and thiono-oxidation of diethyldithiocarbamate methyl ester: role of P-450 enzymes in disulfiram bioactivation. Alcohol Clin Exp Res. 1998 Sep;22(6):1212-9.
138	Dorzolamide. A review of its pharmacology and therapeutic potential in the management of glaucoma and ocular hypertension
139	Identification of cytochrome P450 2E1 as the predominant enzyme catalyzing human liver microsomal defluorination of sevoflurane, isoflurane, and methoxyflurane. Anesthesiology. 1993 Oct;79(4):795-807.
140	Clinical enflurane metabolism by cytochrome P450 2E1. Clin Pharmacol Ther. 1994 Apr;55(4):434-40.
141	Biotransformation of halothane, enflurane, isoflurane, and desflurane to trifluoroacetylated liver proteins: association between protein acylation and hepatic injury
142	Cytochrome P450 isozymes involved in the metabolism of phenol, a benzene metabolite. Toxicol Lett. 2001 Dec 15;125(1-3):117-23.
143	Development of a novel tandem mass spectrometry method for the quantification of eszopiclone without interference from 2-amino-5-chloropyridine and application in a pharmacokinetic study of rat J Pharm Biomed Anal. 2020 Sep 5;188:113363. doi: 10.1016/j.jpba.2020.113363.
144	Chiral aspects of the human metabolism of ethosuximide Biopharm Drug Dispos. 2005 Sep;26(6):225-32. doi: 10.1002/bdd.454.
145	The metabolism of ethosuximide Eur J Drug Metab Pharmacokinet. 1993 Oct-Dec;18(4):349-53. doi: 10.1007/BF03190184.
146	Reactive metabolites of the anticonvulsant drugs and approaches to minimize the adverse drug reaction. Eur J Med Chem. 2021 Dec 15;226:113890. doi: 10.1016/j.ejmech.2021.113890.
147	DrugBank(Pharmacology-Metabolism)Felbamate
148	LABEL:FELBAMATE suspension
149	Kinetics and metabolism of fomepizole in healthy humans Clin Toxicol (Phila). 2012 Jun;50(5):375-83. doi: 10.3109/15563650.2012.683197.
150	DrugBank(Pharmacology-Metabolism)Fospropofol
151	Chemical and enzymatic oxidation of furosemide: formation of pyridinium salts Chem Res Toxicol. 2007 Dec;20(12):1741-4. doi: 10.1021/tx700262z.
152	DrugBank(Pharmacology-Metabolism):Halothane
153	In vitro metabolism of indiplon and an assessment of its drug interaction potential
154	Exploration of inhibition potential of isoniazid and its metabolites towards CYP2E1 in human liver microsomes through LC-MS/MS analysis J Pharm Biomed Anal. 2021 Sep 5;203:114223. doi: 10.1016/j.jpba.2021.114223.
155	A prospective longitudinal study of growth in twin gestations compared with growth in singleton pregnancies. I. The fetal head J Ultrasound Med. 1991 Aug;10(8):439-43. doi: 10.7863/jum.1991.10.8.439.
156	Sulfotransferase 1E1 is a low km isoform mediating the 3-O-sulfation of ethinyl estradiol Drug Metab Dispos. 2004 Nov;32(11):1299-303. doi: 10.1124/dmd.32.11..
157	CYP-eicosanoids--a new link between omega-3 fatty acids and cardiac disease? Prostaglandins Other Lipid Mediat. 2011 Nov;96(1-4):99-108.
158	Inhibitory effects of nicardipine to cytochrome P450 (CYP) in human liver microsomes. Biol Pharm Bull. 2005 May;28(5):882-5.
159	Metabolic pro?ling of tyrosine kinase inhibitor nintedanib using metabolomics J Pharm Biomed Anal. 2020 Feb 20;180:113045. doi: 10.1016/j.jpba.2019.113045.
160	Metabolic Disposition of Osimertinib in Rats, Dogs, and Humans: Insights into a Drug Designed to Bind Covalently to a Cysteine Residue of Epidermal Growth Factor Receptor Drug Metab Dispos. 2016 Aug;44(8):1201-12. doi: 10.1124/dmd.115.069203.
161	Population Pharmacokinetics, Pharmacogenomics, and Adverse Events of Osimertinib and its Two Active Metabolites, AZ5104 and AZ7550, in Japanese Patients with Advanced Non-small Cell Lung Cancer: a Prospective Observational Study. Invest New Drugs. 2023 Feb;41(1):122-133. doi: 10.1007/s10637-023-01328-9.
162	Instability Mechanism of Osimertinib in Plasma and a Solving Strategy in the Pharmacokinetics Study. Front Pharmacol. 2022 Jul 22;13:928983. doi: 10.3389/fphar.2022.928983.
163	CYP2C19 polymorphism effect on phenobarbitone. Pharmacokinetics in Japanese patients with epilepsy: analysis by population pharmacokinetics. Eur J Clin Pharmacol. 2000 Feb-Mar;55(11-12):821-5.
164	DrugBank(Pharmacology-Metabolism)Phenacetin
165	DrugBank(Pharmacology-Metabolism)Phenobarbital
166	Physiologically based pharmacokinetics model of primidone and its metabolites phenobarbital and phenylethylmalonamide in humans, rats, and mice Drug Metab Dispos. 1998 Jun;26(6):585-94.
167	Blood and cerebrospinal fluid pharmacokinetics of primidone and its primary pharmacologically active metabolites, phenobarbital and phenylethylmalonamide in the rat Eur J Drug Metab Pharmacokinet. 1999 Jul-Sep;24(3):255-64. doi: 10.1007/BF03190029.
168	Managing the Drug-Drug Interaction With Apixaban and Primidone: A Case Report. Hosp Pharm. 2023 Aug;58(4):345-349. doi: 10.1177/00185787221150928.
169	Ticagrelor and primidone interaction masquerading as dual antiplatelet therapy noncompliance. Future Cardiol. 2023 Jun 14. doi: 10.2217/fca-2023-0011.
170	Effects of CYP3A Inhibition, CYP3A Induction, and Gastric Acid Reduction on the Pharmacokinetics of Ripretinib, a Switch Control KIT Tyrosine Kinase Inhibitor
171	DrugBank(Pharmacology-Metabolism)Sertraline hydrochloride
172	FDA Approved Drug Products: Ultane (sevoflurane), volatile liquid for inhalation
173	The contributions of cytochromes P450 3A4 and 3A5 to the metabolism of the phosphodiesterase type 5 inhibitors sildenafil, udenafil, and vardenafil. Drug Metab Dispos. 2008 Jun;36(6):986-90.
174	Pharmacokinetics of sildenafil after single oral doses in healthy male subjects: absolute bioavailability, food effects and dose proportionality. Br J Clin Pharmacol. 2002;53 Suppl 1(Suppl 1):5S-12S. doi: 10.1046/j.0306-5251.2001.00027.x.
175	Thalidomide metabolism and hydrolysis: mechanisms and implications
176	Protein binding and the metabolism of thiamylal enantiomers in vitro. Anesth Analg. 2000 Sep;91(3):736-40.
177	Don't stay home without it
178	Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7.
179	Detection of 1,N6-ethenodeoxyadenosine and 3,N4-ethenodeoxycytidine by immunoaffinity/32P-postlabelling in liver and lung DNA of mice treated with ethyl carbamate (urethane) or its metabolites

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.