Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0042)
DME Name UDP-glucuronosyltransferase 1A9 (UGT1A9), Homo sapiens
Synonyms UDP-glucuronosyltransferase family 1 member A9; UDP-glucuronosyltransferase 1-I; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT-1I; UGT1*9; UGT1-09; UGT1.9; UGT1A9; UGT1I; lugP4
Gene Name UGT1A9
UniProt ID
UD19_HUMAN
Gene ID
54600
EC Number    EC: 2.4.1.17     (Click to Show/Hide the Complete EC Tree)
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Microbiome and DME (MICBIO)                       
Jump to Detailed Interactome Data                      
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVT
EYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Pathway Ascorbate and aldarate metabolism (hsa00053 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Function This enzyme has specificity for phenols.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:        72 Drugs
Darolutamide
 Drug Info Approved Prostate cancer ICD11: 2C82 [1]
Bupropion
 Drug Info Approved Nicotine dependence ICD11: 6C4A [2]
Arbidol
 Drug Info Approved Virus infection ICD11: 1A24-1D9Z [3]
Dabigatran etexilate
 Drug Info Approved Venous thromboembolism ICD11: BD72 [4]
Diclofenac sodium
 Drug Info Approved Osteoarthritis ICD11: FA00 [5]
Fospropofol disodium
 Drug Info Approved Monitored anaesthesia care ICD11: N.A. [6]
Valdecoxib
 Drug Info Approved Osteoarthritis ICD11: FA00 [7]
Cannabidiol
 Drug Info Approved Lennox-Gastaut syndrome ICD11: 8A62 [8]
Ethinyl estradiol
 Drug Info Approved Menopausal disorder ICD11: GA30 [9]
Mycophenolate mofetil
 Drug Info Approved Crohn disease ICD11: DD70 [10]
Mycophenolate mofetil
 Drug Info Approved Crohn disease ICD11: DD70 [11]
Valproic acid
 Drug Info Approved Epilepsy ICD11: 8A60 [7]
Ertugliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [12]
Glasdegib
 Drug Info Approved Acute myeloid leukaemia ICD11: 2A60 [13]
Labetalol
 Drug Info Approved Essential hypertension ICD11: BA00 [14]
Opicapone
 Drug Info Approved Parkinsonism ICD11: 8A00 [15]
Alpelisib
 Drug Info Approved Breast cancer ICD11: 2C60 [16]
Regorafenib
 Drug Info Approved Colon cancer ICD11: 2B90 [17]
Regorafenib
 Drug Info Approved Colon cancer ICD11: 2B90 [18]
Axitinib
 Drug Info Approved Renal cell carcinoma ICD11: 2C90 [19]
Diphenylpyraline
 Drug Info Approved Allergy ICD11: 4A80 [20]
Formoterol
 Drug Info Approved Asthma ICD11: CA23 [21]
Haloperidol decanoate
 Drug Info Approved Agitation/aggression ICD11: 6D86 [7]
Lasofoxifene
 Drug Info Approved Osteoporosis ICD11: FB83 [22]
Naproxen
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [23]
Nateglinide
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [7]
Phenylbutazone
 Drug Info Approved Anaesthesia ICD11: 8E22 [24]
Dolutegravir sodium
 Drug Info Approved Human immunodeficiency virus infection ICD11: 1C60 [25]
Eslicarbazepine acetate
 Drug Info Approved Epilepsy ICD11: 8A60 [26]
Etodolac
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [7]
Ibuprofen
 Drug Info Approved Anaesthesia ICD11: 8E22 [7]
Indomethacin
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [27]
Oxymetazoline
 Drug Info Approved Erythema multiforme ICD11: EB12 [28]
Phenytoin
 Drug Info Approved Epilepsy ICD11: 8A60 [29]
Sarpogrelate
 Drug Info Approved Diabetic complication ICD11: 5A2Y [30]
Tapentadol
 Drug Info Approved Neuropathic pain ICD11: 8E43 [31]
Zileuton
 Drug Info Approved Asthma ICD11: CA23 [7]
Clofazimine
 Drug Info Approved Crohn disease ICD11: DD70 [32]
Gemfibrozil
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [33]
Nalbuphine
 Drug Info Approved Pain ICD11: MG30-MG3Z [34]
Propofol
 Drug Info Approved Anaesthesia ICD11: 8E22 [7]
Raloxifene
 Drug Info Approved Osteoporosis ICD11: FB83 [35]
Sulfamethoxazole
 Drug Info Approved Infectious cystitis ICD11: GC00 [7]
Acetaminophen
 Drug Info Approved Anaesthesia ICD11: 8E22 [36]
Canagliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [37]
Dapagliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [38]
Empagliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [39]
Fenofibrate
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [40]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [41]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [42]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [43]
Riociguat
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [44]
Sorafenib
 Drug Info Approved Renal cell carcinoma ICD11: 2C90 [45]
Troglitazone
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [46]
Ambrisentan
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [47]
Bicalutamide
 Drug Info Approved Prostate cancer ICD11: 2C82 [48]
Edaravone
 Drug Info Approved Cerebral stroke ICD11: 8B11 [49]
Entacapone
 Drug Info Approved Parkinsonism ICD11: 8A00 [50]
Flurbiprofen sodium
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [7]
Oxazepam
 Drug Info Approved Anxiety disorder ICD11: 6B00 [51]
Vericiguat
 Drug Info Approved Heart failure ICD11: BD10-BD1Z [52]
Vorinostat
 Drug Info Approved Cutaneous T-cell lymphoma ICD11: 2B01 [53]
Voxelotor
 Drug Info Approved Sickle-cell anaemia ICD11: 3A51 [54]
Artesunate
 Drug Info Approved Malaria ICD11: 1F40-1F45 [55], [56]
Artesunate
 Drug Info Approved Malaria ICD11: 1F40-1F45 [55]
Enasidenib
 Drug Info Approved Acute myeloid leukaemia ICD11: 2A60 [57]
Gaboxadol
 Drug Info Approved Insomnia ICD11: 7A00-7A0Z [58]
Morniflumate
 Drug Info Approved Otitis media ICD11: AA80-AB0Z [59]
Propylthiouracil
 Drug Info Approved Thyrotoxicosis ICD11: 5A02 [60]
Sacituzumab govitecan
 Drug Info Approved Discovery agent ICD: N.A. [61]
Telmisartan
 Drug Info Approved Essential hypertension ICD11: BA00 [62]
LAROPIPRANT
 Drug Info Phase 4 Atherosclerosis ICD11: BA80 [66]
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          7 Drugs
Lumiracoxib
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [7]
Ethinylestradiol propanesulfonate
 Drug Info Phase 4 Prostate cancer ICD11: 2C82 [63], [64]
Artenimol
 Drug Info Phase 4 Malaria ICD11: 1F40 [65]
Ketobemidone
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [7]
Retigabine
 Drug Info Phase 4 Epilepsy ICD11: 8A60 [67]
Silymarin
 Drug Info Phase 4 Fatty liver disease ICD11: DB92 [68], [69]
Dexibuprofen
 Drug Info Phase 4 Osteoarthritis ICD11: FA00 [7]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:        12 Drugs
AKB-6548
 Drug Info Phase 3 Anaemia ICD11: 3A90 [70]
FG-4592
 Drug Info Phase 3 Anaemia ICD11: 3A90 [71]
BMS-298585
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [72]
Curcumin
 Drug Info Phase 3 Stomach cancer ICD11: 2B72 [73]
Tivantinib
 Drug Info Phase 3 Solid tumour/cancer ICD11: 2A00-2F9Z [74]
Bexagliflozin
 Drug Info Phase 3 Type-2 diabetes ICD11: 5A11 [75]
Heroin
 Drug Info Phase 3 Opiate dependence ICD11: 6C43 [76]
BMS-986165
 Drug Info Phase 3 Psoriasis vulgaris ICD11: EA90 [77]
Etirinotecan pegol
 Drug Info Phase 3 Breast cancer ICD11: 2C60-2C6Y [78]
INCB-024360
 Drug Info Phase 3 Renal cell carcinoma ICD11: 2C90 [79]
PTC-124
 Drug Info Phase 3 Cystic fibrosis ICD11: CA25 [80]
Ag-221
 Drug Info Phase 3 Acute myelogenous leukaemia ICD11: 2A41 [81]
      Drugs in Phase 2 Clinical Trial Click to Show/Hide the Full List of Drugs:        14 Drugs
Puerarin
 Drug Info Phase 2 Alcohol dependence ICD11: 6C40 [82]
BAICALEIN
 Drug Info Phase 2 Influenza virus infection ICD11: 1E30-1E32 [83]
LIK-066
 Drug Info Phase 2 Heart failure ICD11: BD10-BD1Z [84]
LJN452
 Drug Info Phase 2 Primary biliary cholangitis ICD11: DB96 [85]
PT2385
 Drug Info Phase 2 Von hippel-lindau disease ICD11: 5A75 [86]
BCP-13498
 Drug Info Phase 2 Anaesthesia ICD11: 8E22 [36]
GSK-1265744
 Drug Info Phase 2 Human immunodeficiency virus infection ICD11: 1C60 [87]
BIA 3-202
 Drug Info Phase 2 Parkinsonism ICD11: 8A00 [88]
FYX-051
 Drug Info Phase 2 Diabetic nephropathy ICD11: GB61 [89]
ASA-404
 Drug Info Phase 2 Prostate cancer ICD11: 2C82 [90]
BAY-85-3934
 Drug Info Phase 2 Anemia ICD11: 3A00-3A9Z [91]
Sitafloxacin
 Drug Info Phase 2 Escherichia coli infection ICD11: 1A03 [92]
SN-38
 Drug Info Phase 2 Colorectal cancer ICD11: 2B91 [93]
KD025
 Drug Info Phase 2 Psoriasis vulgaris ICD11: EA90 [94]
      Drugs in Phase 1 Clinical Trial Click to Show/Hide the Full List of Drugs:          3 Drugs
CB-3304
 Drug Info Phase 1/2 Chronic lymphocytic leukaemia ICD11: 2A82 [95]
LM-94
 Drug Info Phase 1/2 Cholangitis ICD11: DC13 [96]
BRN-0183227
 Drug Info Phase 1 Acute coronary syndrome ICD11: BA4Z [97]
      Discontinued/withdrawn Drugs Click to Show/Hide the Full List of Drugs:          3 Drugs
GV-150526
 Drug Info Discontinued Cerebral stroke ICD11: 8B11 [7]
ML-3000
 Drug Info Discontinued Osteoarthritis ICD11: FA00 [7]
ABT-001
 Drug Info Discontinued Asthma ICD11: CA23 [7]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          5 Drugs
Cotinine
 Drug Info Investigative Nicotine dependence ICD11: 6C4A [98]
Eugenol
 Drug Info Investigative Discovery agent ICD: N.A. [73]
Phloretin
 Drug Info Investigative Discovery agent ICD: N.A. [73]
Chrysin
 Drug Info Investigative Discovery agent ICD: N.A. [73]
Anthraflavic acid
 Drug Info Investigative Discovery agent ICD: N.A. [73]
      Experimental Enzyme Kinetic Data of Drugs Click to Show/Hide the Full List of Drugs:          7 Drugs
Propofol
 Drug Info Approved Anaesthesia Km = 0.0072 microM [96]
Curcumin
 Drug Info Phase 3 Stomach cancer Km = 0.1 microM [73]
LM-94
 Drug Info Phase 1/2 Cholangitis Km = 0.0029 microM [96]
Eugenol
 Drug Info Investigative Discovery agent Km = 0.0084 microM [73]
Phloretin
 Drug Info Investigative Discovery agent Km = 0.0068 microM [73]
Chrysin
 Drug Info Investigative Discovery agent Km = 0.004 microM [73]
Anthraflavic acid
 Drug Info Investigative Discovery agent Km = 0.01 microM [73]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000048 Acetaminophen Acetaminophen glucuronide Conjugation - Glucuronidation Acetaminophen [99], [100], [101]
MR009142 AKB-6548 Vadadustat-O-glucuronide Conjugation - O-glucuronidation AKB-6548 [70]
MR009841 Alpelisib Alpelisib Metabolite M12 Conjugation - N-Glucuronidation Alpelisib [16]
MR009851 Ambrisentan Ambrisentan glucuronide Conjugation - Glucuronidation Ambrisentan [102]
MR008749 Arbidol Arbidol M18 metabolite Conjugation - O-glucuronidation Arbidol [103]
MR008728 Arbidol M1 metabolite Arbidol M13-2 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR008729 Arbidol M1 metabolite Arbidol M13-1 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR008733 Arbidol M3-2 metabolite Arbidol M17-2 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR008736 Arbidol M5 metabolite Arbidol M19 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR008739 Arbidol M6-1 metabolite Arbidol M20 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR008742 Arbidol M7 metabolite Arbidol M21 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR008745 Arbidol M8 metabolite Arbidol M22 metabolite Conjugation - O-glucuronidation Arbidol [3]
MR007264 Catechol intermediate ARQ-501 M2 Conjugation - Monoglucuronidation ARQ-501 [104]
MR000308 Artenimol Alpha-artenimol-beta-glucuronide Conjugation - O-Glucuronidation Artenimol [105]
MR005414 Dihydroartemisinin Dihydroartemisinin Glucuronide Unclear - Unclear Artesunate [55], [56]
MR007276 ASA-404 DMXAA acyl glucuronide Unclear - Unclear ASA-404 [90], [106]
MR009888 Axitinib Axitinib Metabolite M7 Unclear - Unclear axitinib [19]
MR008613 BAICALEIN Baicalein-7-O-glucuronide Unclear - Unclear BAICALEIN [107]
MR011319 BAY-85-3934 BAY-85-3934 Metabolite M1 Unclear - Unclear BAY-85-3934 [108], [91]
MR007298 Paracetamol Unclear Unclear - Unclear BCP-13498 [36]
MR014085 Paracetamol Unclear Unclear BCP-13498 [36]
MR011597 Bexagliflozin EGT0002149 Conjugation - O-glucuronidation Bexagliflozin [75]
MR000364 Bicalutamide S-bicalutamide-glucuronide Unclear - Unclear Bicalutamide [48], [109]
MR000362 Hydroxy(R)bicalutamide R-bicalutamide-glucuronide Unclear - Unclear Bicalutamide [48], [109]
MR000383 BMS-298585 BMS-298585 metabolite M13 Unclear - Unclear BMS-298585 [72], [110]
MR003858 Hesperetin Hesperetin-sulfo-O-glucuronide Unclear - Unclear BRN-0183227 [97]
MR000506 R,R-threohydrobupropion R,R-threohydrobupropion glucuronide Conjugation - Glucuronidation Bupropion [2]
MR000510 R,S-erythrohydrobupropion R,S-erythrohydrobupropion glucuronide Conjugation - Glucuronidation Bupropion [2]
MR000511 S,R-erythrohydrobupropion S,R-erythrohydrobupropion glucuronide Conjugation - Glucuronidation Bupropion [2]
MR000548 Canagliflozin Canagliflozin metabolite M7 Conjugation - O-Glucuronidation Canagliflozin [111]
MR000549 Canagliflozin Canagliflozin metabolite M5 Conjugation - O-Glucuronidation Canagliflozin [111]
MR002826 Capsaicin Capsaicin glucuronide Conjugation - Glucuronidation Capsaicin [112]
MR006094 CB-3304 Glucuronic acid conjugates Conjugation - Conjugation CB-3304 [95]
MR006564 Hydrated clofazimine Hydrated clofazimine glucuronidation Conjugation - Glucuronidation Clofazimine [32]
MR006560 Hydrolytic-deaminated clofazimine Hydrolytic-deaminated clofazimine glucuronide Conjugation - Glucuronidation Clofazimine [32]
MR006562 Hydroxylated clofazimine Hydroxylated clofazimine glucuronidation Conjugation - Glucuronidation Clofazimine [32]
MR005303 Cotinine Cotinine-N-glucuronide Conjugation - Glucuronidation Cotinine [98]
MR005301 Trans-3'-hydroxycotinine Trans-3'-Hydroxycotinine-O-glucuronide Conjugation - Glucuronidation Cotinine [98]
MR012846 Dabigatran Dabigatran Acylglucuronide Unclear - Unclear Dabigatran [113]
MR012846 Dabigatran Dabigatran Acylglucuronide Unclear - Unclear Dabigatran [114]
MR002838 Dapagliflozin Dapagliflozin 3-O-glucuronide metabolite Conjugation - Glucuronidation Dapagliflozin [38]
MR013043 Darexaban maleate Darexaban glucuronide Unclear - Unclear Darexaban maleate [115], [116]
MR003222 Darolutamide Ketodarolutamide Oxidation - Oxidation Darolutamide [117], [118], [119]
MR002618 Diclofenac sodium Diclofenac acyl glucuronide Conjugation - Glucuronidation Diclofenac sodium [120]
MR006617 Dolutegravir sodium Ether glucuronide dolutegravir (M2) Conjugation - Glucuronidation Dolutegravir sodium [25]
MR006689 11-Hydroxy-delta-9-THC 11-Hydroxy-delta-9-THC-glucuronide Conjugation - Glucuronidation Dronabinol [7]
MR000896 Edaravone Edaravone glucuronide conjugates Conjugation - Glucuronidation Edaravone [49]
MR006862 Empagliflozin Empagliflozin-2-glucuronide Conjugation - O-glucuronidation Empagliflozin [121]
MR006868 AGI-16903 Unclear Unclear - Unclear Enasidenib [57]
MR006873 Entacapone cis-isomer Entacapone 3-o-glucuronide Conjugation - Glucuronidation Entacapone [50]
MR000938 Ertugliflozin Ertugliflozin metabolite M4c Conjugation - Glucuronidation Ertugliflozin [122]
MR000938 Ertugliflozin Ertugliflozin metabolite M4c Conjugation - Glucuronidation Ertugliflozin [122]
MR000937 Ertugliflozin Ertugliflozin metabolite M4b Conjugation - Glucuronidation Ertugliflozin [122]
MR000936 Ertugliflozin Ertugliflozin metabolite M4a Conjugation - Glucuronidation Ertugliflozin [122]
MR000930 Ertugliflozin metabolite M2 Ertugliflozin metabolite M5a Unclear - Unclear Ertugliflozin [122]
MR000931 Ertugliflozin metabolite M2 Ertugliflozin metabolite M5c Unclear - Unclear Ertugliflozin [122]
MR007452 Ethanol EtG Unclear - Unclear Ethanol [123]
MR002720 Ethinyl estradiol N-desmethylzopiclone Conjugation - O-Glucuronidation Ethinyl estradiol [9]
MR007155 16alpha-methoxyethinylestradiol 16alpha-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [63], [64]
MR007143 2-methoxyethinylestradiol 2-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [63], [64]
MR007146 4-methoxyethinylestradiol 4-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [63], [64]
MR007149 6-methoxyethinylestradiol 6-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [63], [64]
MR007152 7-methoxyethinylestradiol 7-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [63], [64]
MR007157 Ethinylestradiol propanesulfonate Ethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [63]
MR012145 SN-38 SN-38 glucuronide Unclear - Unclear Etirinotecan pegol [124]
MR002737 Etodolac Etodolac acyl glucuronide Conjugation - Glucuronidation Etodolac [125]
MR003095 Fenofibric acid Fenofibryl glucuronide Conjugation - Glucuronidation Fenofibrate [46]
MR003092 Reduced Fenofibric Acid Reduced Fenofibric Acid glucuronide Conjugation - O-Glucuronidation Fenofibrate [126]
MR003099 Fenofibric acid Fenofibryl glucuronide Conjugation - Glucuronidation Fenofibric acid [46]
MR003097 Reduced Fenofibric Acid Reduced Fenofibric Acid glucuronide Conjugation - O-Glucuronidation Fenofibric acid [126]
MR012061 FG-4592 FG-4592 Metabolites M8 Conjugation - Glucuronidation FG-4592 [127]
MR012064 FG-4592 Metabolites M4 FG-4592 Metabolites M10 Conjugation - Glucuronidation FG-4592 [127]
MR005044 Flurbiprofen sodium Flurbiprofen glucuronide Conjugation - Glucuronidation Flurbiprofen sodium [128]
MR002946 Formoterol Formoterol glucuronide metabolite 1 Conjugation - O-Glucuronidation Formoterol [129], [21]
MR002947 Formoterol Formoterol glucuronide metabolite 2 Conjugation - O-Glucuronidation Formoterol [129], [21]
MR002941 O-demethylated formoterol O-demethylated formoterol glucuronide metabolite 2 Unclear - Unclear Formoterol [130], [21]
MR002942 O-demethylated formoterol O-demethylated formoterol glucuronide metabolite 1 Unclear - Unclear Formoterol [130], [21]
MR003165 Hydroxyphenytoin Hydroxyphenytoin-O-glucuronide metabolite Unclear - Unclear Fosphenytoin sodium [131]
MR003254 4-Quinol sulfate 4-hydroxymethylpyrazole Conjugation - Glucuronidation Fospropofol [7]
MR003262 Propofol Propofol glucuronide Conjugation - Glucuronidation Fospropofol [7]
MR007850 Propofol Propofol-O-glucuronide Conjugation - O-glucuronidation Fospropofol disodium [6]
MR001088 R406 R406 N-glucuronide metabolite Conjugation - N-Glucuronidation Fostamatinib [132]
MR007455 FYX-051 Unclear Conjugation - N1-Glucuronidation FYX-051 [133]
MR007455 FYX-051 Unclear Conjugation - N2-Glucuronidation FYX-051 [133]
MR011092 Gaboxadol Gaboxadol-O-glucuronide Conjugation - O-glucuronidation Gaboxadol [58]
MR001125 Gemfibrozil Gemfibrozil 1-beta-glucuronide metabolite Conjugation - O-Glucuronidation Gemfibrozil [134], [7], [33]
MR005446 GSK-1265744 Cabotegravir M3 Multi-steps Reaction - Oxidationn defluorination; glutathione conjugation GSK-1265744 [87], [135]
MR007469 GSK-1265744 GSK-1265744 M1 Conjugation - O-glucuronidation GSK-1265744 [87]
MR007470 GSK-1265744 GSK-1265744 M2 Conjugation - O-glucuronidation GSK-1265744 [87]
MR005979 GV-150526 Gavestinel acyl glucuronid Conjugation - Glucuronidation GV-150526 [7]
MR005078 Haloperidol decanoate Haloperidol glucuronide Conjugation - Glucuronidation Haloperidol decanoate [7]
MR013333 Morphine Morphine-3-glucuronide Conjugation - Glucuronidation Heroin [76]
MR007031 Hesperetin Hesperetin 3p-O-Glucuronide Conjugation - Glucuronidation Hesperetin [136], [137]
MR007032 Hesperetin Hesperetin 7-O-glucuronide Conjugation - Glucuronidation Hesperetin [136], [137]
MR004643 Ibuprofen Ibuprofen glucuronide Conjugation - O-glucuronidation Ibuprofen [29], [7]
MR003661 INCB-024360 INCB-024360 Metabolite M9 Conjugation - Glucuronidation INCB-024360 [79]
MR001202 Indomethacin Indomethacin acyl glucuronide Conjugation - O-Glucuronidation Indomethacin [27], [138]
MR001385 Labetalol Labetalol Benzyl glucuronide metabolite (II) Conjugation - O-Glucuronidation Labetalol [14], [139]
MR001386 Labetalol Labetalol Phenolic glucuronide metabolite (III) Conjugation - O-Glucuronidation Labetalol [14], [139]
MR001387 Labetalol Labetalol N-glucuronide metabolite Conjugation - O-Glucuronidation Labetalol [14], [139]
MR012315 LIK-066 LIK-066 M17,27 Multi-steps Reaction - Oxidation; direct glucuronidation LIK-066 [84]
MR008303 LJN452 LJN452 metabolite M22 Conjugation - Glucuronidation LJN452 [85]
MR006135 LM-94 4-Methylumbelliferyl glucuronide Conjugation - Conjugation LM-94 [140]
MR001651 17alpha-Ethinylestradiol N-desmethylzopiclone metabolite Conjugation - O-Glucuronidation Mestranol [63], [9], [141]
MR007632 ML-3000 Licofelone acyl glucuronide (M1) Conjugation - Acyl glucuronidation ML-3000 [7]
MR004815 Mycophenolate mofetil Mycophenolic acid glucuronide Conjugation - Glucuronidation Mycophenolate mofetil [142]
MR004816 Mycophenolate mofetil Mycophenolic acyl-glucuronide (AcMPAG) Conjugation - Glucuronidation Mycophenolate mofetil [142]
MR004814 Mycophenolic acid 7-O-MPA glucoside Unclear - Unclear Mycophenolate mofetil [11]
MR004824 Mycophenolic acid Mycophenolic acid glucuronide Conjugation - O-glucuronidation Mycophenolic acid [29], [143]
MR008827 Nalbuphine Nalbuphine-3-beta-D-glucuronide Conjugation - Glucuronidation Nalbuphine [34]
MR004873 O-Desmethylnaproxen O-Desmethylnaproxen acyl glucuronide Conjugation - Glucuronidation Naproxen [7]
MR004872 O-Desmethylnaproxen O-Desmethylnaproxen O-glucuronide Conjugation - Glucuronidation Naproxen [7]
MR002964 Cotinine Cotinine glucuronide metabolite Conjugation - Glucuronidation Nicotine [29]
MR002955 Nicotine Nicotine glucuronide metabolite Conjugation - Glucuronidation Nicotine [29]
MR002862 Oxazepam Oxazepam glucuronide Conjugation - O-Glucuronidation Oxazepam [144]
MR003158 Oxymetazoline Oxymetazoline O-glucuronidation Conjugation - O-Glucuronidation Oxymetazoline [145], [28]
MR002012 Acetaminophen Acetaminophen glucuronide Conjugation - Glucuronidation Phenacetin [146]
MR002877 Phenylbutazone Glucuronides of phenylbutazone Conjugation - Glucuronidation Phenylbutazone [24]
MR002031 Hydroxyphenytoin 4-hydroxyphenytoin o-glucuronide Conjugation - O-Glucuronidation Phenytoin [29], [147]
MR012707 Phloretin Unclear Conjugation - Glucuronidation Phloretin [73]
MR002184 4-hydroxypropofol 1-Quinol glucuronide Conjugation - Glucuronidation Propofol [7]
MR002185 4-hydroxypropofol 4-Quinol glucuronide Conjugation - Glucuronidation Propofol [7]
MR002188 Propofol Propofol glucuronide Conjugation - Glucuronidation Propofol [7]
MR013649 PT2385 M10 PT2385 M1 Multi-steps Reaction - Hydroxylation; Glucuronide conjugation PT2385 [86]
MR013647 PT2385 M2 PT2385 M11 Multi-steps Reaction - Hydroxylation; Glucuronide conjugation PT2385 [86]
MR013643 PT2385 M7 PT2385 M12 Multi-steps Reaction - Oxidative Defluorination; Glucuronide conjugation PT2385 [86]
MR006411 PTC-124 Ataluren-O-1beta-acyl glucuronide Conjugation - Conjugation PTC-124 [80], [148]
MR008594 Puerarin Puerarin-7-O-glucuronide Conjugation - Glucuronidation Puerarin [82]
MR010029 Raloxifene Raloxifen-4-glucoronide(M2) Conjugation - Glucuronidation Raloxifene [35], [149], [150]
MR010030 Raloxifene Raloxifene-6-bate-glucuronide(M1) Conjugation - Glucuronidation Raloxifene [35], [149]
MR010031 Raloxifene Raloxifene-6, 4-diglucuronide(M3) Conjugation - Glucuronidation Raloxifene [35], [149]
MR009524 Regorafenib Regorafenib M7 Conjugation - Glucuronidation Regorafenib [151]
MR009518 Regorafenib M2 Regorafenib M8 Conjugation - Glucuronidation Regorafenib [151]
MR005236 Retigabine Retigabine-N2-glucuronide Conjugation - Glucuronidation Retigabine [152], [67], [153]
MR005237 Retigabine Retigabine-N4-glucuronide Conjugation - Glucuronidation Retigabine [152], [67], [153]
MR009545 Riociguat metabolite M1 Riociguat metabolite M4 Conjugation - N-glucuronidation Riociguat [44]
MR013227 SN-38 10-O-glucuronyl-SN-38 Conjugation - O-gluccuronidation Sacituzumab govitecan [61]
MR008972 Sarpogrelate metabolite M-1 SMG1 Conjugation - Glucuronidation Sarpogrelate [30]
MR005262 Silymarin 20-O-beta-D-Glu Conjugation - Glucuronidation Silymarin [68], [69]
MR005263 Silymarin Silybin 7-glucoside Conjugation - Glucuronidation Silymarin [68], [69]
MR008323 Sitafloxacin Sitafloxacin metabolite M1 Conjugation - Glucuronidation Sitafloxacin [92]
MR007484 SN-38 SN-38G Conjugation - Glucuronidation SN-38 [154], [155]
MR006834 Sorafenib Pyridine N-oxide glucuronide Multi-steps Reaction - Oxidationn; glucuronidation Sorafenib [29], [156]
MR006835 Sorafenib Sorafenib beta-D-Glucuronide Conjugation - Glucuronidation Sorafenib [29]
MR002336 Tapentadol Tapentadol O-sulfate Conjugation - Conjugation Tapentadol [157], [31], [158]
MR011605 Tivantinib Metabolite M4 Tivantinib Metabolite M15,16 Unclear - Unclear Tivantinib [74]
MR011608 Tivantinib Metabolite M5 Tivantinib Metabolite M15,16 Unclear - Unclear Tivantinib [74]
MR002497 Valproic acid Valproic acid beta-O-glucuronide metabolite Oxidation - Dehydrogenation Valproic acid [7]
MR010912 Vericiguat Vericiguat Metabolite M2 Conjugation - N-glucuronidation Vericiguat [52]
MR005667 Vorinostat Vorinostat-O-Glucuronide metabolite Unclear - Unclear Vorinostat [159], [160]
MR005675 Voxelotor Unclear Conjugation - Glucuronidation Voxelotor [54]
MR013301 Zileuton Zileuton O-glucuronide metabolite Conjugation - N-hydroxy glucuronidation Zileuton [7], [161]
⏷ Show the Full List of 152 MR(s)
References
1 Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
2 DrugBank(Pharmacology-Metabolism)Bupropion
3 DrugBank(Pharmacology-Metabolism):Arbidol
4 Dabigatran acylglucuronide, the major human metabolite of dabigatran: in vitro formation, stability, and pharmacological activity. Drug Metab Dispos. 2010 Sep;38(9):1567-75.
5 Glucuronidation of nonsteroidal anti-inflammatory drugs: identifying the enzymes responsible in human liver microsomes. Drug Metab Dispos. 2005 Jul;33(7):1027-35.
6 Metabolic Profiles of Propofol and Fospropofol: Clinical and Forensic Interpretative Aspects
7 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
8 Cytochrome P450-Catalyzed Metabolism of Cannabidiol to the Active Metabolite 7-Hydroxy-Cannabidiol Drug Metab Dispos. 2021 Oct;49(10):882-891. doi: 10.1124/dmd.120.000350.
9 Human bilirubin UDP-glucuronosyltransferase catalyzes the glucuronidation of ethinylestradiol Mol Pharmacol. 1993 Apr;43(4):649-54.
10 The evolution of population pharmacokinetic models to describe the enterohepatic recycling of mycophenolic acid in solid organ transplantation and autoimmune disease. Clin Pharmacokinet. 2011 Jan;50(1):1-24.
11 DrugBank(Pharmacology-Metabolism):Mycophenolate mofetil
12 The effect of renal impairment on the pharmacokinetics and pharmacodynamics of ertugliflozin in subjects with type 2 diabetes mellitus. J Clin Pharmacol. 2017 Nov;57(11):1432-1443.
13 Metabolism, excretion and pharmacokinetics of [14C]glasdegib (PF-04449913) in healthy volunteers following oral administration. Xenobiotica. 2017 Dec;47(12):1064-1076.
14 Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
15 Metabolism and disposition of opicapone in the rat and metabolic enzymes phenotyping
16 Absorption, distribution, metabolism, and excretion of [(14)C]BYL719 (alpelisib) in healthy male volunteers. Cancer Chemother Pharmacol. 2015 Oct;76(4):751-60.
17 FDA Label of Regorafenib. The 2020 official website of the U.S. Food and Drug Administration.
18 Method development and validation for simultaneous determination of six tyrosine kinase inhibitors and two active metabolites in human plasma/serum using UPLC-MS/MS for therapeutic drug monitoring
19 In Vitro Kinetic Characterization of Axitinib Metabolism
20 In?vitro metabolism of fenofibric acid by carbonyl reducing enzymes Chem Biol Interact. 2016 Oct 25;258:153-8. doi: 10.1016/j.cbi.2016.09.001.
21 FDA Approved Drug Products: Perforomist? inhalation solution
22 DrugBank(Pharmacology-Metabolism):Lasofoxifene
23 S-Naproxen and desmethylnaproxen glucuronidation by human liver microsomes and recombinant human UDP-glucuronosyltransferases (UGT): role of UGT2B7 in the elimination of naproxen. Br J Clin Pharmacol. 2005 Oct;60(4):423-33.
24 Identification of human UDP-glucuronosyltransferase isoform(s) responsible for the C-glucuronidation of phenylbutazone. Arch Biochem Biophys. 2006 Oct 1;454(1):72-9.
25 Metabolism, excretion, and mass balance of the HIV-1 integrase inhibitor dolutegravir in humans
26 Pharmacokinetics and drug interactions of eslicarbazepine acetate Epilepsia. 2012 Jun;53(6):935-46. doi: 10.1111/j.1528-1167.2012.03519.x.
27 Contribution of UDP-glucuronosyltransferases 1A9 and 2B7 to the glucuronidation of indomethacin in the human liver. Eur J Clin Pharmacol. 2007 Mar;63(3):289-96.
28 Identification and characterization of oxymetazoline glucuronidation in human liver microsomes: evidence for the involvement of UGT1A9. J Pharm Sci. 2011 Feb;100(2):784-93.
29 Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
30 Glucuronidation of a sarpogrelate active metabolite is mediated by UDP-glucuronosyltransferases 1A4, 1A9, and 2B4
31 Investigations into the drug-drug interaction potential of tapentadol in human liver microsomes and fresh human hepatocytes. Drug Metab Lett. 2008 Jan;2(1):67-75.
32 Characterization of Clofazimine Metabolism in Human Liver Microsomal Incubation In Vitro
33 The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver. Drug Metab Dispos. 2007 Nov;35(11):2040-4.
34 A dual system platform for drug metabolism: Nalbuphine as a model compound
35 Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9
36 Polymorphic expression of UGT1A9 is associated with variable acetaminophen glucuronidation in neonates: a population pharmacokinetic and pharmacogenetic study. Clin Pharmacokinet. 2018 Oct;57(10):1325-1336.
37 Effects of rifampin, cyclosporine A, and probenecid on the pharmacokinetic profile of canagliflozin, a sodium glucose co-transporter 2 inhibitor, in healthy participants. Int J Clin Pharmacol Ther. 2015 Feb;53(2):115-28.
38 Pharmacokinetics and pharmacodynamics of dapagliflozin, a novel selective inhibitor of sodium-glucose co-transporter type 2, in Japanese subjects without and with type 2 diabetes mellitus
39 Empagliflozin (Jardiance): a novel SGLT2 inhibitor for the treatment of type-2 diabetes. P T. 2015 Jun;40(6):364-8.
40 Drug-drug interactions for UDP-glucuronosyltransferase substrates: a pharmacokinetic explanation for typically observed low exposure (AUCi/AUC) ratios. Drug Metab Dispos. 2004 Nov;32(11):1201-8.
41 Diabetes mellitus reduces activity of human UDP-glucuronosyltransferase 2B7 in liver and kidney leading to decreased formation of mycophenolic acid acyl-glucuronide metabolite. Drug Metab Dispos. 2011 Mar;39(3):448-55.
42 Identification of the UDP-glucuronosyltransferase isoforms involved in mycophenolic acid phase II metabolism. Drug Metab Dispos. 2005 Jan;33(1):139-46.
43 C-440T/T-331C polymorphisms in the UGT1A9 gene affect the pharmacokinetics of mycophenolic acid in kidney transplantation
44 Clinical Pharmacokinetic and Pharmacodynamic Profile of Riociguat
45 Pharmacokinetic interaction involving sorafenib and the calcium-channel blocker felodipine in a patient with hepatocellular carcinoma. Invest New Drugs. 2011 Dec;29(6):1511-4.
46 The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene. J Biol Chem. 2003 Apr 18;278(16):13975-83.
47 Clinical pharmacokinetics and drug-drug interactions of endothelin receptor antagonists in pulmonary arterial hypertension. J Clin Pharmacol. 2012 Dec;52(12):1784-805.
48 Enantiomer selective glucuronidation of the non-steroidal pure anti-androgen bicalutamide by human liver and kidney: role of the human UDP-glucuronosyltransferase (UGT)1A9 enzyme Basic Clin Pharmacol Toxicol. 2013 Aug;113(2):92-102. doi: 10.1111/bcpt.12071.
49 LABEL:ADICAVA- edaravone injection RADICAVA ORS- edaravone kit
50 Kinetic characterization of the 1A subfamily of recombinant human UDP-glucuronosyltransferases. Drug Metab Dispos. 2005 Jul;33(7):1017-26.
51 Stereoselective conjugation of oxazepam by human UDP-glucuronosyltransferases (UGTs): S-oxazepam is glucuronidated by UGT2B15, while R-oxazepam is glucuronidated by UGT2B7 and UGT1A9 Drug Metab Dispos. 2002 Nov;30(11):1257-65. doi: 10.1124/dmd.30.11.1257.
52 Vericiguat: A New Hope for Heart Failure Patients
53 Age-dependent hepatic UDP-glucuronosyltransferase gene expression and activity in children. Front Pharmacol. 2016 Nov 16;7:437.
54 FDA Approved Drug Products:Oxbryta (voxelotor) tablets
55 Glucuronidation of dihydroartemisinin in vivo and by human liver microsomes and expressed UDP-glucuronosyltransferases
56 LC-MS/MS method for the simultaneous quantification of artesunate and its metabolites dihydroartemisinin and dihydroartemisinin glucuronide in human plasma
57 FDA:Enasidenib
58 Metabolism and renal elimination of gaboxadol in humans: role of UDP-glucuronosyltransferases and transporters
59 DrugBank(Pharmacology-Metabolism):Morniflumate
60 Simultaneous Quantification of Propylthiouracil and Its N--d Glucuronide by HPLC-MS/MS: Application to a Metabolic Study
61 New Insights into SN-38 Glucuronidation: Evidence for the Important Role of UDP Glucuronosyltransferase 1A9
62 In vitro glucuronidation of the angiotensin II receptor antagonist telmisartan in the cat: a comparison with other species
63 Genetic variation in the first-pass metabolism of ethinylestradiol, sex hormone binding globulin levels and venous thrombosis risk Eur J Intern Med. 2017 Jul;42:54-60. doi: 10.1016/j.ejim.2017.05.019.
64 Metabolism of 17 alpha-ethinylestradiol by human liver microsomes in vitro: aromatic hydroxylation and irreversible protein binding of metabolites J Clin Endocrinol Metab. 1974 Dec;39(6):1072-80. doi: 10.1210/jcem-39-6-1072.
65 Eurartesim - European Medicines Agency
66 Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans
67 Retigabine N-glucuronidation and its potential role in enterohepatic circulation. Drug Metab Dispos. 1999 May;27(5):605-12.
68 Evidence for differences in regioselective and stereoselective glucuronidation of silybin diastereomers from milk thistle (Silybum marianum) by human UDP-glucuronosyltransferases
69 Metabolism, Transport and Drug-Drug Interactions of Silymarin
70 DrugBank(Pharmacology-Metabolism):AKB-6548
71 Effect of Kidney Function and Dialysis on the Pharmacokinetics and Pharmacodynamics of Roxadustat, an Oral Hypoxia-Inducible Factor Prolyl Hydroxylase Inhibitor
72 Involvement of multiple cytochrome P450 and UDP-glucuronosyltransferase enzymes in the in vitro metabolism of muraglitazar. Drug Metab Dispos. 2007 Jan;35(1):139-49.
73 Differential and special properties of the major human UGT1-encoded gastrointestinal UDP-glucuronosyltransferases enhance potential to control chemical uptake. J Biol Chem. 2004 Jan 9;279(2):1429-41.
74 Stereoselective hydroxylation by CYP2C19 and oxidation by ADH4 in the in vitro metabolism of tivantinib
75 Metabolism and disposition of the SGLT2 inhibitor bexagliflozin in rats, monkeys and humans
76 PharmGKB:Heroin
77 DrugBank(Pharmacology-Metabolism):BMS-986165
78 Etirinotecan pegol in women with recurrent platinum-resistant or refractory ovarian cancer
79 Roles of UGT, P450, and Gut Microbiota in the Metabolism of Epacadostat in Humans
80 Ataluren pharmacokinetics in healthy Japanese and Caucasian subjects. Clin Pharmacol Drug Dev. 2019 Feb;8(2):172-178.
81 DrugBank(Pharmacology-Metabolism):Ag-221
82 UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for puerarin metabolism in human liver microsomes
83 Involvement of UDP-glucuronosyltransferases in the extensive liver and intestinal first-pass metabolism of flavonoid baicalein
84 Pharmacokinetics, metabolism, and excretion of licogliflozin, a dual inhibitor of SGLT1/2, in rats, dogs, and humans
85 Evaluation of the Absorption, Metabolism, and Excretion of a Single Oral 1-mg Dose of Tropifexor in Healthy Male Subjects and the Concentration Dependence of Tropifexor Metabolism
86 Metabolic Profiling of the Novel Hypoxia-Inducible Factor 2 Inhibitor PT2385 In Vivo and In Vitro
87 Disposition and metabolism of cabotegravir: a comparison of biotransformation and excretion between different species and routes of administration in humans. Xenobiotica. 2016;46(2):147-62.
88 Human metabolism of nebicapone (BIA 3-202), a novel catechol-o-methyltransferase inhibitor: characterization of in vitro glucuronidation
89 Characterization of N-glucuronidation of 4-(5-pyridin-4-yl-1H-[1,2,4]triazol-3-yl) pyridine-2-carbonitrile (FYX-051): a new xanthine oxidoreductase inhibitor. Drug Metab Dispos. 2007 Dec;35(12):2143-8.
90 Predicting pharmacokinetics and drug interactions in patients from in vitro and in vivo models: the experience with 5,6-dimethylxanthenone-4-acetic acid (DMXAA), an anti-cancer drug eliminated mainly by conjugation. Drug Metab Rev. 2002 Nov;34(4):751-90.
91 Drug-drug interaction of atazanavir on UGT1A1-mediated glucuronidation of molidustat in human
92 Acyl glucuronidation of fluoroquinolone antibiotics by the UDP-glucuronosyltransferase 1A subfamily in human liver microsomes
93 Correlation between plasma concentration ratios of SN-38 glucuronide and SN-38 and neutropenia induction in patients with colorectal cancer and wild-type UGT1A1 gene. Oncol Lett. 2012 Mar;3(3):694-698.
94 DrugBank(Pharmacology-Metabolism):KD025
95 Metabolic map and bioactivation of the anti-tumour drug noscapine
96 The "albumin effect" and drug glucuronidation: bovine serum albumin and fatty acid-free human serum albumin enhance the glucuronidation of UDP-glucuronosyltransferase (UGT) 1A9 substrates but not UGT1A1 and UGT1A6 activities. Drug Metab Dispos. 2008 Jun;36(6):1056-62.
97 Stratification of Volunteers According to Flavanone Metabolite Excretion and Phase II Metabolism Profile after Single Doses of 'Pera' Orange and 'Moro' Blood Orange Juices
98 Interindividual variability in nicotine metabolism: C-oxidation and glucuronidation
99 Simultaneous quantification of abemaciclib and its active metabolites in human and mouse plasma by UHPLC-MS/MS J Pharm Biomed Anal. 2021 Sep 5;203:114225. doi: 10.1016/j.jpba.2021.114225.
100 Application of a Volumetric Absorptive Microsampling (VAMS)-Based Method for the Determination of Paracetamol and Four of its Metabolites as a Tool for Pharmacokinetic Studies in Obese and Non-Obese Patients. Clin Pharmacokinet. 2022 Dec;61(12):1719-1733. doi: 10.1007/s40262-022-01187-2.
101 Evaluation of urinary acetaminophen metabolites and its association with the genetic polymorphisms of the metabolising enzymes, and serum acetaminophen concentrations in preterm neonates with patent ductus arteriosus. Xenobiotica. 2021 Nov;51(11):1335-1342. doi: 10.1080/00498254.2021.1982070.
102 Effect of ketoconazole on the pharmacokinetic profile of ambrisentan. J Clin Pharmacol. 2009 Jun;49(6):719-24.
103 Pharmacokinetics, metabolism, and excretion of the antiviral drug arbidol in humans
104 Metabolic profile, enzyme kinetics, and reaction phenotyping of -lapachone metabolism in human liver and intestine in vitro
105 DrugBank(Pharmacology-Metabolism)Artenimol
106 Preclinical factors affecting the interindividual variability in the clearance of the investigational anti-cancer drug 5,6-dimethylxanthenone-4-acetic acid. Biochem Pharmacol. 2003 Jun 1;65(11):1853-65.
107 Hepatic metabolism and disposition of baicalein via the coupling of conjugation enzymes and transporters-in vitro and in vivo evidences
108 Oxazolidinones as versatile scaffolds in medicinal chemistry
109 Dailymed:Bicalutamide
110 Glucuronidation as a major metabolic clearance pathway of 14c-labeled muraglitazar in humans: metabolic profiles in subjects with or without bile collection Drug Metab Dispos. 2006 Mar;34(3):427-39. doi: 10.1124/dmd.105.007617.
111 Clinical Pharmacokinetic, Pharmacodynamic, and Drug-Drug Interaction Profile of Canagliflozin, a Sodium-Glucose Co-transporter 2 Inhibitor Clin Pharmacokinet. 2015 Oct;54(10):1027-41. doi: 10.1007/s40262-015-0285-z.
112 Glucuronidation of capsaicin by liver microsomes and expressed UGT enzymes: reaction kinetics, contribution of individual enzymes and marked species differences Expert Opin Drug Metab Toxicol. 2014 Oct;10(10):1325-36. doi: 10.1517/17425255.2014.954548.
113 #N/A
114 Dabigatran Acylglucuronide, the Major Metabolite of Dabigatran, Shows a Weaker Anticoagulant Effect than Dabigatran
115 Absorption, metabolism and excretion of darexaban (YM150), a new direct factor Xa inhibitor in humans
116 Identification of UDP-glucuronosyltransferases responsible for the glucuronidation of darexaban, an oral factor Xa inhibitor, in human liver and intestine
117 Clinical Development of Darolutamide: A Novel Androgen Receptor Antagonist for the Treatment of Prostate Cancer Clin Genitourin Cancer. 2018 Oct;16(5):332-340. doi: 10.1016/j.clgc.2018.07.017.
118 Drug-Drug Interaction Study to Evaluate the Pharmacokinetics, Safety, and Tolerability of Ipatasertib in Combination with Darolutamide in Patients with Advanced Prostate Cancer. Pharmaceutics. 2022 Oct 1;14(10):2101. doi: 10.3390/pharmaceutics14102101.
119 Clinical Pharmacokinetics of the Androgen Receptor Inhibitor Darolutamide in Healthy Subjects and Patients with Hepatic or Renal Impairment. Clin Pharmacokinet. 2022 Apr;61(4):565-575. doi: 10.1007/s40262-021-01078-y.
120 DrugBank(Pharmacology-Metabolism)Diclofenac sodium
121 Pharmacokinetics, Pharmacodynamics and Clinical Use of SGLT2 Inhibitors in Patients with Type 2 Diabetes Mellitus and Chronic Kidney Disease
122 Pharmacokinetics, metabolism, and excretion of the antidiabetic agent ertugliflozin (PF-04971729) in healthy male subjects Drug Metab Dispos. 2013 Feb;41(2):445-56. doi: 10.1124/dmd.112.049551.
123 Identification and preliminary characterization of UDP-glucuronosyltransferases catalyzing formation of ethyl glucuronide. Anal Bioanal Chem. 2014 Apr;406(9-10):2325-32.
124 Integrated population pharmacokinetics of etirinotecan pegol and its four metabolites in cancer patients with solid tumors
125 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
126 In vitro metabolism of fenofibric acid by carbonyl reducing enzymes. Chem Biol Interact. 2016 Oct 25;258:153-8.
127 Identification of Hypoxia-inducible factor (HIF) stabilizer roxadustat and its possible metabolites in thoroughbred horses for doping control
128 DrugBank(Pharmacology-Metabolism):Flurbiprofen
129 Mass balance and metabolism of [(3)H]Formoterol in healthy men after combined i.v. and oral administration-mimicking inhalation Drug Metab Dispos. 1999 Oct;27(10):1104-16.
130 DrugBank : Formoterol
131 U. S. FDA Label -Fosphenytoin sodium
132 DrugBank(Pharmacology-Metabolism)Fostamatinib
133 DrugBank(Pharmacology-Metabolism):FYX-051
134 Intracellular pharmacokinetics of gemcitabine, its deaminated metabolite 2',2'-difluorodeoxyuridine and their nucleotides Br J Clin Pharmacol. 2018 Jun;84(6):1279-1289. doi: 10.1111/bcp.13557.
135 Correction to "Mechanistic Basis of Cabotegravir-Glucuronide Disposition in Humans"
136 BioTransformer: a comprehensive computational tool for small molecule metabolism prediction and metabolite identification
137 Molecular mechanism of hesperetin-7-O-glucuronide, the main circulating metabolite of hesperidin, involved in osteoblast differentiation
138 Herb-drug interaction in the protective effect of Alpinia officinarum against gastric injury induced by indomethacin based on pharmacokinetic, tissue distribution and excretion studies in rats. J Pharm Anal. 2021 Apr;11(2):200-209. doi: 10.1016/j.jpha.2020.05.009.
139 Pregnancy-Related Hormones Increase UGT1A1-Mediated Labetalol Metabolism in Human Hepatocytes Front Pharmacol. 2021 Apr 15;12:655320. doi: 10.3389/fphar.2021.655320.
140 Comparisons of detections, stabilities, and kinetics of degradation of hymecromone and its glucuronide and sulfate metabolites
141 The potent inhibition of human cytosolic sulfotransferase 1A1 by 17-ethinylestradiol is due to interactions with isoleucine 89 on loop 1 Horm Mol Biol Clin Investig. 2014 Dec;20(3):81-90. doi: 10.1515/hmbci-2014-0028.
142 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
143 The main role of UGT1A9 in the hepatic metabolism of mycophenolic acid and the effects of naturally occurring variants
144 Stereoselective conjugation of oxazepam by human UDP-glucuronosyltransferases (UGTs): S-oxazepam is glucuronidated by UGT2B15, while R-oxazepam is glucuronidated by UGT2B7 and UGT1A9. Drug Metab Dispos. 2002 Nov;30(11):1257-65.
145 In vitro metabolism of oxymetazoline: evidence for bioactivation to a reactive metabolite. Drug Metab Dispos. 2011 Apr;39(4):693-702.
146 DrugBank(Pharmacology-Metabolism)Phenacetin
147 Biotransformation of phenytoin in the electrochemically-driven CYP2C19 system. Biophys Chem. 2022 Dec;291:106894. doi: 10.1016/j.bpc.2022.106894.
148 LC-MS/MS quantification of ataluren and ataluren acyl glucuronide in human plasma/urine: application in clinical studies
149 Determination of raloxifene and its glucuronides in human urine by liquid chromatography-tandem mass spectrometry assay
150 Pharmacokinetics of raloxifene and its clinical application
151 Mass balance, metabolic disposition, and pharmacokinetics of a single oral dose of regorafenib in healthy human subjects
152 Retigabine: the newer potential antiepileptic drug
153 N-Glucuronidation of the antiepileptic drug retigabine: results from studies with human volunteers, heterologously expressed human UGTs, human liver, kidney, and liver microsomal membranes of Crigler-Najjar type II. Metabolism. 2006 Jun;55(6):711-21.
154 Clinical pharmacokinetics and metabolism of irinotecan (CPT-11)
155 Individualization of Irinotecan Treatment: A Review of Pharmacokinetics, Pharmacodynamics, and Pharmacogenetics
156 Interaction of sorafenib and cytochrome P450 isoenzymes in patients with advanced melanoma: a phase I/II pharmacokinetic interaction study. Cancer Chemother Pharmacol. 2011 Nov;68(5):1111-8.
157 On the Molecular Basis Underlying the Metabolism of Tapentadol Through Sulfation Eur J Drug Metab Pharmacokinet. 2017 Oct;42(5):793-800. doi: 10.1007/s13318-016-0392-8.
158 A case report on fatal intoxication by tapentadol: Study of distribution and metabolism Forensic Sci Int. 2021 Jul;324:110825. doi: 10.1016/j.forsciint.2021.110825.
159 Stability studies of vorinostat and its two metabolites in human plasma, serum and urine
160 Uridine 5'-diphospho-glucuronosyltransferase genetic polymorphisms and response to cancer chemotherapy. Future Oncol. 2010 Apr;6(4):563-85.
161 Synthetic and natural compounds that interact with human cytochrome P450 1A2 and implications in drug development. Curr Med Chem. 2009;16(31):4066-218.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.