Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0040)
DME Name UDP-glucuronosyltransferase 2B7 (UGT2B7), Homo sapiens
Synonyms UDP-glucuronosyltransferase family 2 member B7; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronosyltransferase 2B9; UDPGT 2B7; UDPGT 2B9; UDPGTh-2; UGT2B7; UGTB2B9
Gene Name UGT2B7
UniProt ID
UD2B7_HUMAN
Gene ID
7364
EC Number    EC: 2.4.1.17     (Click to Show/Hide the Complete EC Tree)
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Microbiome and DME (MICBIO)                       
Jump to Detailed Interactome Data                      
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND
Structure
2O6L
Pathway Ascorbate and aldarate metabolism (hsa00053 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Function This enzyme is uniquely specific for 3,4-catechol estrogens and estriol which suggests it may play an important role in regulating the level and activity of these potent and active estrogen metabolites. And it is also active with androsterone, hyodeoxycholic acid and tetrachlorocatechol (in vitro).
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:        82 Drugs
Bupropion
 Drug Info Approved Nicotine dependence ICD11: 6C4A [1]
Tamoxifen citrate
 Drug Info Approved Breast cancer ICD11: 2C60 [2]
Yn-968D1
 Drug Info Approved Breast cancer ICD11: 2C60-2C6Y [3]
Arbidol
 Drug Info Approved Virus infection ICD11: 1A24-1D9Z [4]
Dabigatran etexilate
 Drug Info Approved Venous thromboembolism ICD11: BD72 [5]
Diclofenac sodium
 Drug Info Approved Osteoarthritis ICD11: FA00 [6]
Loxoprofen gel
 Drug Info Approved Inflammation ICD11: 1A00-CA43 [7]
Naloxone
 Drug Info Approved Opiate dependence ICD11: 6C43 [8]
Beta carotene
 Drug Info Approved Vitamin deficiency ICD11: 5B55 [9]
Cannabidiol
 Drug Info Approved Lennox-Gastaut syndrome ICD11: 8A62 [10]
Ethinyl estradiol
 Drug Info Approved Menopausal disorder ICD11: GA30 [11]
Mycophenolate mofetil
 Drug Info Approved Crohn disease ICD11: DD70 [12]
Pitavastatin
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [13]
Silodosin
 Drug Info Approved Prostatic hyperplasia ICD11: GA90 [14]
Valproic acid
 Drug Info Approved Epilepsy ICD11: 8A60 [15]
Bempedoic acid
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [16]
Ertugliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [17]
Labetalol
 Drug Info Approved Essential hypertension ICD11: BA00 [18]
Mirabegron
 Drug Info Approved Overactive bladder ICD11: GC50 [19]
Opicapone
 Drug Info Approved Parkinsonism ICD11: 8A00 [20]
Ketorolac
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [21]
Spironolactone
 Drug Info Approved Congestive heart failure ICD11: BD10-BD1Z [22]
Suprofen
 Drug Info Approved Iris sphincter disorder ICD11: 9B01 [23]
Vildagliptin
 Drug Info Approved Type-2 diabetes ICD11: 5A11 [24]
Carvedilol
 Drug Info Approved Congestive heart failure ICD11: BD10 [25]
Dextromethorphan hydrobromide
 Drug Info Approved Atherosclerosis ICD11: BA80 [23]
Formoterol
 Drug Info Approved Asthma ICD11: CA23 [26]
Naproxen
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [6]
Rofecoxib
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [27]
Belinostat
 Drug Info Approved Anaplastic large cell lymphoma ICD11: 2A90 [28], [29]
Bromfenac
 Drug Info Approved Cataract ICD11: 9B10 [30]
Carbamazepine
 Drug Info Approved Epilepsy ICD11: 8A60 [31]
Cenobamate
 Drug Info Approved Focal seizure ICD11: 8A68 [32]
Cenobamate
 Drug Info Approved Focal seizure ICD11: 8A68 [33]
Codeine
 Drug Info Approved Anaesthesia ICD11: 8E22 [34]
Efavirenz
 Drug Info Approved Human immunodeficiency virus infection ICD11: 1C60 [35]
Eslicarbazepine acetate
 Drug Info Approved Epilepsy ICD11: 8A60 [36]
Etodolac
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [6]
Ibuprofen
 Drug Info Approved Anaesthesia ICD11: 8E22 [6]
Indomethacin
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [37]
Midazolam hydrochloride
 Drug Info Approved Anxiety disorder ICD11: 6B00 [38], [39], [40]
Morphine
 Drug Info Approved Anaesthesia ICD11: 8E22 [41]
Morphine
 Drug Info Approved Anaesthesia ICD11: 8E22 [42], [43], [44]
Simvastatin
 Drug Info Approved Dyslipidaemia ICD11: 5C81 [45]
Tapentadol
 Drug Info Approved Neuropathic pain ICD11: 8E43 [46]
Varenicline
 Drug Info Approved Nicotine dependence ICD11: 6C4A [47]
Abacavir
 Drug Info Approved Human immunodeficiency virus infection ICD11: 1C60 [48]
Anastrozole
 Drug Info Approved Breast cancer ICD11: 2C60 [49]
Buprenorphine hydrochloride
 Drug Info Approved Anaesthesia ICD11: 8E22 [50]
Gemfibrozil
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [51]
Nalbuphine
 Drug Info Approved Pain ICD11: MG30-MG3Z [52]
Nalmefene
 Drug Info Approved Opiate dependence ICD11: 6C43 [53]
Tramadol hydrochloride
 Drug Info Approved Neuropathic pain ICD11: 8E43 [54]
Dapagliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [55]
Empagliflozin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [56]
Epirubicin
 Drug Info Approved Breast cancer ICD11: 2C60 [57]
Ezetimibe
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [58]
Losartan potassium
 Drug Info Approved Essential hypertension ICD11: BA00 [6]
Lovastatin
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [45]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [59]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [60]
Pitavastatin calcium
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [61]
Troglitazone
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [62]
Zidovudine
 Drug Info Approved Human immunodeficiency virus infection ICD11: 1C60 [63]
Ambrisentan
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [64]
Bicalutamide
 Drug Info Approved Prostate cancer ICD11: 2C82 [65]
Clopidogrel bisulfate
 Drug Info Approved Acute coronary syndrome ICD11: BA4Z [66]
Edaravone
 Drug Info Approved Cerebral stroke ICD11: 8B11 [67]
Fenoprofen
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [68]
Fluconazole
 Drug Info Approved Candidiasis ICD11: 1F23 [69]
Flurbiprofen sodium
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [6]
Hydromorphone
 Drug Info Approved Anaesthesia ICD11: 8E22 [70]
Oxazepam
 Drug Info Approved Anxiety disorder ICD11: 6B00 [71]
Selexipag
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [72]
Vorinostat
 Drug Info Approved Cutaneous T-cell lymphoma ICD11: 2B01 [73]
Artesunate
 Drug Info Approved Malaria ICD11: 1F40-1F45 [74], [75]
Artesunate
 Drug Info Approved Malaria ICD11: 1F40-1F45 [74]
Carprofen
 Drug Info Approved Anaesthesia ICD11: 8E22 [76]
Letrozole
 Drug Info Approved Breast cancer ICD11: 2C60 [77]
Lorazepam
 Drug Info Approved Anxiety disorder ICD11: 6B00 [15]
Osilodrostat
 Drug Info Approved Cushing syndrome ICD11: 5A70 [78]
LAROPIPRANT
 Drug Info Phase 4 Atherosclerosis ICD11: BA80 [83]
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          8 Drugs
Ethinylestradiol propanesulfonate
 Drug Info Phase 4 Prostate cancer ICD11: 2C82 [79], [80]
Artenimol
 Drug Info Phase 4 Malaria ICD11: 1F40 [81]
Acemetacin
 Drug Info Phase 4 Osteoarthritis ICD11: FA00 [82]
Dihydrocodeine
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [84]
Silymarin
 Drug Info Phase 4 Fatty liver disease ICD11: DB92 [85], [86]
Zaltoprofen
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [6]
Dexibuprofen
 Drug Info Phase 4 Osteoarthritis ICD11: FA00 [6]
Denopamine
 Drug Info Phase 4 Congestive heart failure ICD11: BD10 [87]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:        11 Drugs
AKB-6548
 Drug Info Phase 3 Anaemia ICD11: 3A90 [88]
ABL001
 Drug Info Phase 3 Chronic myelogenous leukaemia ICD11: 2A20 [89]
Heroin
 Drug Info Phase 3 Opiate dependence ICD11: 6C43 [90]
Losartan
 Drug Info Phase 3 Hypertension ICD11: BA00-BA04 [91]
LCQ908-NXA
 Drug Info Phase 3 Hypertriglyceridaemia ICD11: 5C80 [92]
Fevipiprant
 Drug Info Phase 3 Asthma ICD11: CA23 [93]
Glinsuna
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [6], [94]
KAD-1229
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [95]
Ag-221
 Drug Info Phase 3 Acute myelogenous leukaemia ICD11: 2A41 [96]
CS-011
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [97]
CS-600G
 Drug Info Phase 3 Epilepsy ICD11: 8A60 [7]
      Drugs in Phase 2 Clinical Trial Click to Show/Hide the Full List of Drugs:        13 Drugs
UK-453,061
 Drug Info Phase 2 Human immunodeficiency virus infection ICD11: 1C60 [98]
LIK-066
 Drug Info Phase 2 Heart failure ICD11: BD10-BD1Z [99]
Ethanol
 Drug Info Phase 2 Diabetic nephropathy ICD11: GB61 [100]
PT2385
 Drug Info Phase 2 Von hippel-lindau disease ICD11: 5A75 [101]
BIA 3-202
 Drug Info Phase 2 Parkinsonism ICD11: 8A00 [102]
(Z)-endoxifen
 Drug Info Phase 2 Breast cancer ICD11: 2C60-2C6Y [103]
BIIB074
 Drug Info Phase 2 Bipolar disorder ICD11: 6A60 [104]
Endoxifen
 Drug Info Phase 2 Breast cancer ICD11: 2C60-2C6Y [103]
MPC-4326
 Drug Info Phase 2 Human immunodeficiency virus infection ICD11: 1C60 [105]
ABT-751
 Drug Info Phase 2 Breast cancer ICD11: 2C60 [106]
ASA-404
 Drug Info Phase 2 Prostate cancer ICD11: 2C82 [107]
BN-1270
 Drug Info Phase 2 Pulmonary hypertension ICD11: BB01 [108]
Estetrol
 Drug Info Phase 2 Diabetes mellitus ICD11: 5A10 [109]
      Drugs in Phase 1 Clinical Trial Click to Show/Hide the Full List of Drugs:          5 Drugs
CB-3304
 Drug Info Phase 1/2 Chronic lymphocytic leukaemia ICD11: 2A82 [110]
DA-1229
 Drug Info Phase 1 Type-2 diabetes ICD11: 5A11 [111]
BRN-3224996
 Drug Info Phase 1 Allergy ICD11: 4A80 [112]
GTPL-1666
 Drug Info Phase 1 Cerebral vasospasm ICD11: BA85 [113]
Norbuprenorphine
 Drug Info Phase 1 Human immunodeficiency virus infection ICD11: 1C60-1C62 [114]
      Discontinued/withdrawn Drugs Click to Show/Hide the Full List of Drugs:          2 Drugs
BMS-204352
 Drug Info Discontinued in Phase 3 Nerve injury ICD11: ND56 [115]
ML-3000
 Drug Info Discontinued Osteoarthritis ICD11: FA00 [6]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          5 Drugs
Cotinine
 Drug Info Investigative Nicotine dependence ICD11: 6C4A [116]
BRN-3548355
 Drug Info Investigative Discovery agent ICD: N.A. [117]
Alpha-dihydroaldosterone
 Drug Info Investigative Discovery agent ICD: N.A. [112]
BRN-1999480
 Drug Info Investigative Discovery agent ICD: N.A. [118]
Tetrahydroaldosterone
 Drug Info Investigative Discovery agent ICD: N.A. [112]
      Experimental Enzyme Kinetic Data of Drugs Click to Show/Hide the Full List of Drugs:          4 Drugs
Zidovudine
 Drug Info Approved Human immunodeficiency virus infection Km = 0.551 microM [63]
BRN-3224996
 Drug Info Phase 1 Allergy Km = 0.00036 microM [112]
Alpha-dihydroaldosterone
 Drug Info Investigative Discovery agent Km = 0.00023 microM [112]
Tetrahydroaldosterone
 Drug Info Investigative Discovery agent Km = 0.00197 microM [112]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000005 Abacavir 361W94(glucuronide) Conjugation - Glucuronidation Abacavir [119]
MR005421 ABL001 Asciminib metabolite M30.5 Conjugation - Glucuronidation ABL001 [120]
MR007242 ABT-751 ABT-751 glucuronide Unclear - Unclear ABT-751 [106]
MR000034 Deacyl indomethacin Deacyl indomethacin glucuronide Unclear - Unclear Acemetacin [121]
MR000035 O-demethylatedacemetacin Acemetacin-acyl-beta-D-glucuronide Conjugation - Glucuronidation Acemetacin [121]
MR000037 O-desmethyl-des-4-chlorobenzoyl O-desmethyl-des-4-chlorobenzoyl glucuronide Conjugation - Glucuronidation Acemetacin [121]
MR000038 O-desmethyl-des-4-chlorobenzoyl Des-p-chlorobenzoyl-O-desmethylindometacinsulfate Unclear - Unclear Acemetacin [122]
MR009143 AKB-6548 Vadadustat acyl glucuronide Conjugation - O-glucuronidation AKB-6548 [88]
MR009851 Ambrisentan Ambrisentan glucuronide Conjugation - Glucuronidation Ambrisentan [123]
MR008749 Arbidol Arbidol M18 metabolite Conjugation - O-glucuronidation Arbidol [124]
MR008728 Arbidol M1 metabolite Arbidol M13-2 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR008729 Arbidol M1 metabolite Arbidol M13-1 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR008733 Arbidol M3-2 metabolite Arbidol M17-2 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR008736 Arbidol M5 metabolite Arbidol M19 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR008739 Arbidol M6-1 metabolite Arbidol M20 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR008742 Arbidol M7 metabolite Arbidol M21 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR008745 Arbidol M8 metabolite Arbidol M22 metabolite Conjugation - O-glucuronidation Arbidol [4]
MR007263 Catechol intermediate ARQ-501 M1 Conjugation - Monoglucuronidation ARQ-501 [125]
MR000308 Artenimol Alpha-artenimol-beta-glucuronide Conjugation - O-Glucuronidation Artenimol [126]
MR005414 Dihydroartemisinin Dihydroartemisinin Glucuronide Unclear - Unclear Artesunate [74], [75]
MR007276 ASA-404 DMXAA acyl glucuronide Unclear - Unclear ASA-404 [127], [107]
MR005441 ESP15228 ESP15228-glucuronide Unclear - Unclear Bempedoic acid [16]
MR005438 ETC-1002-CoA Glucuronide conjugates Unclear - Unclear Bempedoic acid [16]
MR005733 4-Oxoretinoic acid 4-oxo-retinoyl glucuronide Conjugation - Glucuronidation Beta carotene [9]
MR000362 Hydroxy(R)bicalutamide R-bicalutamide-glucuronide Unclear - Unclear Bicalutamide [65], [128]
MR008292 BIIB074 BIIB074 metabolite M13 Conjugation - N-carbamoyl glucuronidation BIIB074 [104]
MR009445 BMS-204352 BMS-204352 Metabolite M1 Conjugation - Glucuronidation BMS-204352 [129]
MR007326 BN-1270 Glucuronidation of ( - )-cicletanine Conjugation - Glucuronidatioin BN-1270 [108]
MR007569 BRN-1999480 Glucuronidation of 4-hydroxyestrone Unclear - Unclear BRN-1999480 [118]
MR007573 BRN-3548355 Unclear Unclear - Unclear BRN-3548355 [117]
MR014091 BRN-3548355 Unclear Unclear BRN-3548355 [117]
MR000461 Bromfenac Bromfenac glucuronide intemediate Unclear - Unclear Bromfenac [30], [130]
MR000492 Bupivacaine hydrochloride Buprenorphine glucuronide Conjugation - Glucuronidation Buprenorphine hydrochloride [131], [50], [132], [133]
MR000496 R,R-hydroxybupropion R,R-hydroxybupropion glucuronide Conjugation - Glucuronidation Bupropion [1]
MR000510 R,S-erythrohydrobupropion R,S-erythrohydrobupropion glucuronide Conjugation - Glucuronidation Bupropion [1]
MR000511 S,R-erythrohydrobupropion S,R-erythrohydrobupropion glucuronide Conjugation - Glucuronidation Bupropion [1]
MR000494 S,S-hydroxybupropion S,S-hydroxybupropion glucuronide Conjugation - Glucuronidation Bupropion [1]
MR000508 S,S-threohydrobupropion S,S-threohydrobupropion glucuronide Conjugation - Glucuronidation Bupropion [1]
MR002826 Capsaicin Capsaicin glucuronide Conjugation - Glucuronidation Capsaicin [134]
MR002590 Carbamazepine Carbamazepine N-glucuronide Conjugation - N-Glucuronidation Carbamazepine [135]
MR000563 Carprofen Carprofen glucuronide Conjugation - Glucuronidation Carprofen [76], [136]
MR000574 Carvedilol Carvedilol glucuronide Conjugation - O-Glucuronidation Carvedilol [137]
MR006094 CB-3304 Glucuronic acid conjugates Conjugation - Conjugation CB-3304 [110]
MR000596 Cenobamate Cenobamate metabolite M1 Conjugation - Glucuronidation Cenobamate [138]
MR000597 Cenobamate Cenobamate metabolite M11 Conjugation - Glucuronidation Cenobamate [138]
MR000598 Cenobamate Cenobamate metabolite M3 Conjugation - Glucuronidation Cenobamate [138]
MR000599 Cenobamate Cenobamate metabolite M2a/2b Conjugation - Glucuronidation Cenobamate [138]
MR006594 Clopidogrel carboxylic acid derivative Clopidogrel acyl glucuronide Conjugation - Glucuronidation Clopidogrel bisulfate [66]
MR004096 Codeine Morphine Conjugation - Glucuronidation Codeine [139], [140], [141]
MR004099 Morphine Normorphine Conjugation - Glucuronidation Codeine [142]
MR004097 Morphine Morphine 3 glucuronide Conjugation - Glucuronidation Codeine [143]
MR005301 Trans-3'-hydroxycotinine Trans-3'-Hydroxycotinine-O-glucuronide Conjugation - Glucuronidation Cotinine [116]
MR007435 CYC-202 CYC-202 M6 Conjugation - Glucuronidation CYC-202 [144]
MR008452 4S-Hydroxyevogliptin 4S-Hydroxyevogliptin glucuronide Conjugation - Glucuronidation DA-1229 [111]
MR012846 Dabigatran Dabigatran Acylglucuronide Unclear - Unclear Dabigatran [145]
MR012846 Dabigatran Dabigatran Acylglucuronide Unclear - Unclear Dabigatran [146]
MR007086 Denopamine Denopamine Metabolite G2 Conjugation - Glucuronidation Denopamine [87]
MR000815 3-hydroxymorphinan 3-hydroxymorphinan O-glucuronide Conjugation - Glucuronidation Dextromethorphan hydrobromide [147], [148]
MR000815 3-hydroxymorphinan 3-hydroxymorphinan O-glucuronide Conjugation - Glucuronidation Dextromethorphan hydrobromide [6], [148]
MR000813 Dextrorphan Dextrorphan O-glucuronide Conjugation - Glucuronidation Dextromethorphan hydrobromide [147], [149], [150]
MR002618 Diclofenac sodium Diclofenac acyl glucuronide Conjugation - Glucuronidation Diclofenac sodium [151]
MR007117 Dihydrocodeine Dihydrocodeine-6-glucuronide Conjugation - Glucuronidation Dihydrocodeine [152], [84]
MR000896 Edaravone Edaravone glucuronide conjugates Conjugation - Glucuronidation Edaravone [67]
MR006862 Empagliflozin Empagliflozin-2-glucuronide Conjugation - O-glucuronidation Empagliflozin [153]
MR011558 Endoxifen Endoxifen O-Glucuronide Unclear - Unclear Endoxifen [103]
MR009954 Epirubicin Epirubicin-glucuronide Unclear - Unclear Epirubicin [154], [57]
MR000936 Ertugliflozin Ertugliflozin metabolite M4a Conjugation - Glucuronidation Ertugliflozin [155]
MR000930 Ertugliflozin metabolite M2 Ertugliflozin metabolite M5a Unclear - Unclear Ertugliflozin [155]
MR000931 Ertugliflozin metabolite M2 Ertugliflozin metabolite M5c Unclear - Unclear Ertugliflozin [155]
MR007452 Ethanol EtG Unclear - Unclear Ethanol [100]
MR002720 Ethinyl estradiol N-desmethylzopiclone Conjugation - O-Glucuronidation Ethinyl estradiol [11]
MR007155 16alpha-methoxyethinylestradiol 16alpha-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [79], [80]
MR007143 2-methoxyethinylestradiol 2-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [79], [80]
MR007146 4-methoxyethinylestradiol 4-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [79], [80]
MR007149 6-methoxyethinylestradiol 6-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [79], [80]
MR007152 7-methoxyethinylestradiol 7-methoxyethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [79], [80]
MR007157 Ethinylestradiol propanesulfonate Ethinylestradiol-glucuronide Conjugation - O-glucuronidation Ethinylestradiol propanesulfonate [79]
MR002737 Etodolac Etodolac acyl glucuronide Conjugation - Glucuronidation Etodolac [23]
MR001008 Ezetimibe Ezetimibe-glucuronide Conjugation - Glucuronidation Ezetimibe [58], [156], [157], [158]
MR012009 Fevipiprant AG met Unclear - Unclear Fevipiprant [93], [159]
MR001059 Fluconazole Fluconazole O-Glucuronidated metabolite Conjugation - Glucuronidation Fluconazole [69], [160]
MR005044 Flurbiprofen sodium Flurbiprofen glucuronide Conjugation - Glucuronidation Flurbiprofen sodium [161]
MR002946 Formoterol Formoterol glucuronide metabolite 1 Conjugation - O-Glucuronidation Formoterol [162], [26]
MR002947 Formoterol Formoterol glucuronide metabolite 2 Conjugation - O-Glucuronidation Formoterol [162], [26]
MR002941 O-demethylated formoterol O-demethylated formoterol glucuronide metabolite 2 Unclear - Unclear Formoterol [163], [26]
MR001125 Gemfibrozil Gemfibrozil 1-beta-glucuronide metabolite Conjugation - O-Glucuronidation Gemfibrozil [164], [6], [51]
MR012935 Glinsuna Glinsuna Metabolite M1 Conjugation - Glucuronidation Glinsuna [6], [94]
MR013333 Morphine Morphine-3-glucuronide Conjugation - Glucuronidation Heroin [90]
MR013332 Morphine Morphine-6-glucuronide Conjugation - Glucuronidation Heroin [90]
MR005138 Hydromorphone Hydromorphone-3-glucuronide Conjugation - Glucuronidation Hydromorphone [165], [166], [70]
MR004643 Ibuprofen Ibuprofen glucuronide Conjugation - O-glucuronidation Ibuprofen [42], [6]
MR001202 Indomethacin Indomethacin acyl glucuronide Conjugation - O-Glucuronidation Indomethacin [37], [167]
MR003683 KAD-1229 Mitiglinide carboxyl-glucuronide Conjugation - Conjugation KAD-1229 [95]
MR001369 Ketorolac Rac Ketorolac glucuronide Conjugation - Glucuronidation Ketorolac [168]
MR001385 Labetalol Labetalol Benzyl glucuronide metabolite (II) Conjugation - O-Glucuronidation Labetalol [18], [169]
MR001386 Labetalol Labetalol Phenolic glucuronide metabolite (III) Conjugation - O-Glucuronidation Labetalol [18], [169]
MR001387 Labetalol Labetalol N-glucuronide metabolite Conjugation - O-Glucuronidation Labetalol [18], [169]
MR003712 LCQ908-NXA M18.4 Conjugation - Glucuronidation LCQ908-NXA [92], [170]
MR001446 4,4'-methanol-bisbenzonitrile Letrozole carbinol glucuronide metabolite Conjugation - Glucuronidation Letrozole [77]
MR012315 LIK-066 LIK-066 M17,27 Multi-steps Reaction - Oxidation; direct glucuronidation LIK-066 [99]
MR006905 Lorazepam Lorazepam glucuronide Conjugation - Glucuronidation Lorazepam [171], [15]
MR013898 Losartan LOG Unclear - Unclear Losartan [91]
MR013899 Losartan LN1G Unclear - Unclear Losartan [91]
MR013900 Losartan LN2G Unclear - Unclear Losartan [91]
MR006915 Losartan potassium Losartan N2-glucuronide Conjugation - N-glucuronidation Losartan potassium [172]
MR006922 beta-hydroxy acid of lovastatin 6'-beta-Hydroxylovastatin Oxidation - Hydrolyzationn Lovastatin [45]
MR007963 Loxoprofen cis-OH metabolite Loxoprofen gel metabolite M16 Unclear - Unclear Loxoprofen gel [173], [7]
MR007966 Loxoprofen gel Loxoprofen gel metabolite M14 Unclear - Unclear Loxoprofen gel [173], [7]
MR007958 Loxoprofen trans-OH metabolite Loxoprofen gel metabolite M16 Unclear - Unclear Loxoprofen gel [173], [7]
MR001651 17alpha-Ethinylestradiol N-desmethylzopiclone metabolite Conjugation - O-Glucuronidation Mestranol [79], [11], [174]
MR004745 Midazolam hydrochloride 1-hydroxymidazolam glucuronide Conjugation - N-glucuronidation Midazolam hydrochloride [38], [39], [40]
MR004746 Midazolam hydrochloride 4-hydroxymidazolam glucuronide Conjugation - N-glucuronidation Midazolam hydrochloride [38], [39]
MR004782 Mirabegron Mirabegron M11 metabolite Conjugation - O-glucuronidation Mirabegron [19]
MR007632 ML-3000 Licofelone acyl glucuronide (M1) Conjugation - Acyl glucuronidation ML-3000 [6]
MR004804 Morphine Morphine glucuronide Conjugation - Glucuronidation Morphine [42], [43], [44]
MR004805 Morphine Morphine-3-glucuronide Conjugation - Glucuronidation Morphine [43], [42], [175]
MR009658 MPC-4326 Mono-BVMG () Conjugation - Glucuronidation MPC-4326 [176]
MR009658 MPC-4326 Mono-BVMG () Conjugation - Glucuronidation MPC-4326 [105]
MR009659 MPC-4326 Mono-BVMG () Conjugation - Glucuronidation MPC-4326 [105]
MR009660 MPC-4326 Di-BVMG Conjugation - Glucuronidation MPC-4326 [105]
MR009659 MPC-4326 Mono-BVMG () Conjugation - Glucuronidation MPC-4326 [176]
MR004822 Mycophenolic acid Mycophenolic acid-acyl glucuronide Conjugation - Glucuronidation Mycophenolic acid [42], [177], [178]
MR008827 Nalbuphine Nalbuphine-3-beta-D-glucuronide Conjugation - Glucuronidation Nalbuphine [52]
MR008828 Nalbuphine Nalbuphine-6-beta-D-glucuronide Conjugation - Glucuronidation Nalbuphine [52]
MR010774 Nalmefene Nalmefene 3-O-glucuronide Conjugation - O-glucuronidation Nalmefene [179]
MR010790 Naloxone Naloxone Metabolite M7 Unclear - Unclear Naloxone [180], [8]
MR004873 O-Desmethylnaproxen O-Desmethylnaproxen acyl glucuronide Conjugation - Glucuronidation Naproxen [6]
MR013758 Norbuprenorphine Norbuprenorphine metabolite M1 Unclear - Unclear Norbuprenorphine [50]
MR013702 Opicapone BIA 9-1106 Conjugation - Glucuronidation Opicapone [181]
MR008871 Osilodrostat Osilodrostat glucuronide Unclear - Unclear Osilodrostat [78]
MR002862 Oxazepam Oxazepam glucuronide Conjugation - O-Glucuronidation Oxazepam [71]
MR002069 Pitavastatin Pitavastatin glucuronide Conjugation - Glucuronidation Pitavastatin calcium [182]
MR013651 PT2385 PT2385 M8 Conjugation - Glucuronide conjugation PT2385 [101]
MR013063 5-OH-rofecoxib 5-OH-rofecoxib O-glucuronide Conjugation - Glucuronidation Rofecoxib [6], [27]
MR002238 ACT-333679 ME9Qgl9thj Conjugation - Glucuronidation Selexipag [72]
MR002255 KMD-3241 KMD-3241 glucuronide Conjugation - Glucuronidation Silodosin [183]
MR002257 Silodosin Silodosin glucuronide Conjugation - Glucuronidation Silodosin [183]
MR005262 Silymarin 20-O-beta-D-Glu Conjugation - Glucuronidation Silymarin [85], [86]
MR005263 Silymarin Silybin 7-glucoside Conjugation - Glucuronidation Silymarin [85], [86]
MR013437 Simvastatin Unclear Unclear - Unclear Simvastatin [184]
MR002307 Suprofen Suprofen glucuronide Conjugation - Glucuronidation Suprofen [6]
MR002336 Tapentadol Tapentadol O-sulfate Conjugation - Conjugation Tapentadol [185], [46], [186]
MR003375 O-Desmethyltramadol O-Desmethyl-tramado glucuronide metabolite Oxidation - N-Demethylation Tramadol hydrochloride [54]
MR002497 Valproic acid Valproic acid beta-O-glucuronide metabolite Oxidation - Dehydrogenation Valproic acid [6]
MR008846 Varenicline Varenicline N-carbamoyl glucuronide Conjugation - N-carbamoyl glucosidation Varenicline [47]
MR008781 Vildagliptin Vildagliptin M20.2 metabolite Conjugation - Glucuronidation Vildagliptin [187], [188], [24]
MR005667 Vorinostat Vorinostat-O-Glucuronide metabolite Unclear - Unclear Vorinostat [189], [190]
MR009648 Zaltoprofen Zaltoprofen acyl glucuronide Conjugation - Glucuronidation Zaltoprofen [6]
MR005678 Zidovudine 3'-azido-3'-deoxy-5'- O-beta-D-glucopyranuronosylthymidine Conjugation - Glucuronidation Zidovudine [191], [192]
⏷ Show the Full List of 149 MR(s)
References
1 DrugBank(Pharmacology-Metabolism)Bupropion
2 Metabolism and transport of tamoxifen in relation to its effectiveness: new perspectives on an ongoing controversy. Future Oncol. 2014 Jan;10(1):107-22.
3 Metabolism and pharmacokinetics of novel selective vascular endothelial growth factor receptor-2 inhibitor apatinib in humans
4 DrugBank(Pharmacology-Metabolism):Arbidol
5 Dabigatran acylglucuronide, the major human metabolite of dabigatran: in vitro formation, stability, and pharmacological activity. Drug Metab Dispos. 2010 Sep;38(9):1567-75.
6 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
7 Exploring the metabolism of loxoprofen in liver microsomes: the role of cytochrome P450 and UDP-glucuronosyltransferase in its biotransformation. Pharmaceutics. 2018 Aug 2;10(3). pii: E112.
8 PBPK Modeling as a Tool for Predicting and Understanding Intestinal Metabolism of Uridine 5'-Diphospho-glucuronosyltransferase Substrates
9 #NAME?
10 Cytochrome P450-Catalyzed Metabolism of Cannabidiol to the Active Metabolite 7-Hydroxy-Cannabidiol Drug Metab Dispos. 2021 Oct;49(10):882-891. doi: 10.1124/dmd.120.000350.
11 Human bilirubin UDP-glucuronosyltransferase catalyzes the glucuronidation of ethinylestradiol Mol Pharmacol. 1993 Apr;43(4):649-54.
12 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
13 DrugBank(Pharmacology-Metabolism):Pitavastatin
14 Pharmacokinetics and disposition of silodosin (KMD-3213). Yakugaku Zasshi. 2006 Mar;126 Spec no.:237-45.
15 Pharmacokinetic and pharmacodynamic interaction of lorazepam and valproic acid in relation to UGT2B7 genetic polymorphism in healthy subjects. Clin Pharmacol Ther. 2008 Apr;83(4):595-600.
16 DrugBank(Pharmacology-Metabolism):Bempedoic acid
17 The effect of renal impairment on the pharmacokinetics and pharmacodynamics of ertugliflozin in subjects with type 2 diabetes mellitus. J Clin Pharmacol. 2017 Nov;57(11):1432-1443.
18 Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
19 Identification of Uridine 5'-Diphosphate-Glucuronosyltransferases Responsible for the Glucuronidation of Mirabegron, a Potent and Selective (3)-Adrenoceptor Agonist, in Human Liver Microsomes
20 Metabolism and disposition of opicapone in the rat and metabolic enzymes phenotyping
21 Body weight, gender and pregnancy affect enantiomer-specific ketorolac pharmacokinetics. Br J Clin Pharmacol. 2017 Sep;83(9):1966-1975.
22 Spironolactone and canrenone inhibit UGT2B7-catalyzed human liver and kidney microsomal aldosterone 18beta-glucuronidation: a potential drug interaction
23 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
24 Dipeptidyl peptidase-4 greatly contributes to the hydrolysis of vildagliptin in human liver
25 Drug-drug interactions for UDP-glucuronosyltransferase substrates: a pharmacokinetic explanation for typically observed low exposure (AUCi/AUC) ratios. Drug Metab Dispos. 2004 Nov;32(11):1201-8.
26 FDA Approved Drug Products: Perforomist? inhalation solution
27 Involvement of human UGT2B7 and 2B15 in rofecoxib metabolism
28 Glucuronidation by UGT1A1 is the dominant pathway of the metabolic disposition of belinostat in liver cancer patients. PLoS One. 2013;8(1):e54522.
29 In vitro characterization of belinostat glucuronidation: demonstration of both UGT1A1 and UGT2B7 as the main contributing isozymes
30 Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
31 Association of carbamazepine major metabolism and transport pathway gene polymorphisms and pharmacokinetics in patients with epilepsy. Pharmacogenomics. 2013 Jan;14(1):35-45.
32 FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
33 DrugBank(Pharmacology-Metabolism):Cenobamate
34 Human UGT2B7 catalyzes morphine glucuronidation. Drug Metab Dispos. 1997 Jan;25(1):1-4.
35 Biotransformation of Efavirenz and Proteomic Analysis of Cytochrome P450s and UDP-Glucuronosyltransferases in Mouse, Macaque, and Human Brain-Derived In Vitro Systems. Drug Metab Dispos. 2023 Apr;51(4):521-531. doi: 10.1124/dmd.122.001195.
36 Pharmacokinetics and drug interactions of eslicarbazepine acetate Epilepsia. 2012 Jun;53(6):935-46. doi: 10.1111/j.1528-1167.2012.03519.x.
37 Contribution of UDP-glucuronosyltransferases 1A9 and 2B7 to the glucuronidation of indomethacin in the human liver. Eur J Clin Pharmacol. 2007 Mar;63(3):289-96.
38 The inhibition study of human UDP-glucuronosyltransferases with cytochrome P450 selective substrates and inhibitors
39 Contribution of the N-glucuronidation pathway to the overall in vitro metabolic clearance of midazolam in humans
40 The Oral Bioavailability and Metabolism of Midazolam in Stable Critically Ill Children: A Pharmacokinetic Microtracing Study
41 Molecular cloning of the baboon UDP-glucuronosyltransferase 2B gene family and their activity in conjugating morphine. Drug Metab Dispos. 2010 Apr;38(4):545-53.
42 Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
43 Metabolism and pharmacokinetics of morphine in neonates: A review
44 Morphine metabolism, transport and brain disposition
45 Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
46 Investigations into the drug-drug interaction potential of tapentadol in human liver microsomes and fresh human hepatocytes. Drug Metab Lett. 2008 Jan;2(1):67-75.
47 Metabolism and disposition of varenicline, a selective alpha4beta2 acetylcholine receptor partial agonist, in vivo and in vitro
48 Product characteristics of Triumeq.
49 In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
50 Contribution of the different UDP-glucuronosyltransferase (UGT) isoforms to buprenorphine and norbuprenorphine metabolism and relationship with the main UGT polymorphisms in a bank of human liver microsomes. Drug Metab Dispos. 2010 Jan;38(1):40-5.
51 The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver. Drug Metab Dispos. 2007 Nov;35(11):2040-4.
52 A dual system platform for drug metabolism: Nalbuphine as a model compound
53 Ema.europa:Nalmefene
54 DrugBank : Tramadol hydrochloride
55 Clinical pharmacokinetics and pharmacodynamics of dapagliflozin, a selective inhibitor of sodium-glucose co-transporter type 2. Clin Pharmacokinet. 2014 Jan;53(1):17-27.
56 Empagliflozin (Jardiance): a novel SGLT2 inhibitor for the treatment of type-2 diabetes. P T. 2015 Jun;40(6):364-8.
57 Epirubicin glucuronidation and UGT2B7 developmental expression. Drug Metab Dispos. 2006 Dec;34(12):2097-101.
58 Ezetimibe: a review of its metabolism, pharmacokinetics and drug interactions. Clin Pharmacokinet. 2005;44(5):467-94.
59 Diabetes mellitus reduces activity of human UDP-glucuronosyltransferase 2B7 in liver and kidney leading to decreased formation of mycophenolic acid acyl-glucuronide metabolite. Drug Metab Dispos. 2011 Mar;39(3):448-55.
60 Effect of UGT polymorphisms on pharmacokinetics and adverse reactions of mycophenolic acid in kidney transplant patients
61 Pitavastatin: a review in hypercholesterolemia. Am J Cardiovasc Drugs. 2017 Apr;17(2):157-168.
62 Troglitazone glucuronidation in human liver and intestine microsomes: high catalytic activity of UGT1A8 and UGT1A10. Drug Metab Dispos. 2002 Dec;30(12):1462-9.
63 Determination of UDP-glucuronosyltransferase UGT2B7 activity in human liver microsomes by ultra-performance liquid chromatography with MS detection. J Chromatogr B Analyt Technol Biomed Life Sci. 2008 Jul 1;870(1):84-90.
64 Clinical pharmacokinetics and drug-drug interactions of endothelin receptor antagonists in pulmonary arterial hypertension. J Clin Pharmacol. 2012 Dec;52(12):1784-805.
65 Enantiomer selective glucuronidation of the non-steroidal pure anti-androgen bicalutamide by human liver and kidney: role of the human UDP-glucuronosyltransferase (UGT)1A9 enzyme Basic Clin Pharmacol Toxicol. 2013 Aug;113(2):92-102. doi: 10.1111/bcpt.12071.
66 Physiologically Based Pharmacokinetic (PBPK) Modeling of Clopidogrel and Its Four Relevant Metabolites for CYP2B6, CYP2C8, CYP2C19, and CYP3A4 Drug-Drug-Gene Interaction Predictions
67 LABEL:ADICAVA- edaravone injection RADICAVA ORS- edaravone kit
68 Dataset of the first report of pharmacogenomics profiling in an outpatient spine setting
69 The disposition and metabolism of [14C]fluconazole in humans Drug Metab Dispos. 1991 Jul-Aug;19(4):764-7.
70 Opioid therapies and cytochrome p450 interactions. J Pain Symptom Manage. 2012 Dec;44(6 Suppl):S4-14.
71 Stereoselective conjugation of oxazepam by human UDP-glucuronosyltransferases (UGTs): S-oxazepam is glucuronidated by UGT2B15, while R-oxazepam is glucuronidated by UGT2B7 and UGT1A9. Drug Metab Dispos. 2002 Nov;30(11):1257-65.
72 FDA LABEL:elexipag
73 Age-dependent hepatic UDP-glucuronosyltransferase gene expression and activity in children. Front Pharmacol. 2016 Nov 16;7:437.
74 Glucuronidation of dihydroartemisinin in vivo and by human liver microsomes and expressed UDP-glucuronosyltransferases
75 LC-MS/MS method for the simultaneous quantification of artesunate and its metabolites dihydroartemisinin and dihydroartemisinin glucuronide in human plasma
76 Enantioselective inhibition of carprofen towards UDP-glucuronosyltransferase (UGT) 2B7. Chirality. 2015 Mar;27(3):189-93.
77 The letrozole phase 1 metabolite carbinol as a novel probe drug for UGT2B7 Drug Metab Dispos. 2013 Nov;41(11):1906-13. doi: 10.1124/dmd.113.053405.
78 DrugBank(Pharmacology-Metabolism):Osilodrostat
79 Genetic variation in the first-pass metabolism of ethinylestradiol, sex hormone binding globulin levels and venous thrombosis risk Eur J Intern Med. 2017 Jul;42:54-60. doi: 10.1016/j.ejim.2017.05.019.
80 Metabolism of 17 alpha-ethinylestradiol by human liver microsomes in vitro: aromatic hydroxylation and irreversible protein binding of metabolites J Clin Endocrinol Metab. 1974 Dec;39(6):1072-80. doi: 10.1210/jcem-39-6-1072.
81 Eurartesim - European Medicines Agency
82 Seyffart G. (1992). Drug dosage in renal insufficiency (2nd ed.). Springer Science+Business Media Dordrecht.
83 Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans
84 Adult and infant pharmacokinetic profiling of dihydrocodeine using physiologically based pharmacokinetic modeling. Biopharm Drug Dispos. 2019 Nov;40(9):350-357.
85 Evidence for differences in regioselective and stereoselective glucuronidation of silybin diastereomers from milk thistle (Silybum marianum) by human UDP-glucuronosyltransferases
86 Metabolism, Transport and Drug-Drug Interactions of Silymarin
87 Regioselective glucuronidation of denopamine: marked species differences and identification of human udp-glucuronosyltransferase isoform. Drug Metab Dispos. 2005 Mar;33(3):403-12.
88 DrugBank(Pharmacology-Metabolism):AKB-6548
89 Pharmacokinetics of asciminib in the presence of CYP3A or P-gp inhibitors, CYP3A inducers, and acid-reducing agents
90 PharmGKB:Heroin
91 The human UDP-glucuronosyltransferase UGT1A3 is highly selective towards N2 in the tetrazole ring of losartan, candesartan, and zolarsartan. Biochem Pharmacol. 2008 Sep 15;76(6):763-72.
92 Pradigastat disposition in humans: in vivo and in vitro investigations. Xenobiotica. 2017 Dec;47(12):1077-1089.
93 Clinical Investigation of Metabolic and Renal Clearance Pathways Contributing to the Elimination of Fevipiprant Using Probenecid as Perpetrator. Drug Metab Dispos. 2021 May;49(5):389-394. doi: 10.1124/dmd.120.000273.
94 Carboxyl-glucuronidation of mitiglinide by human UDP-glucuronosyltransferases. Biochem Pharmacol. 2007 Jun 1;73(11):1842-51.
95 Mitiglinide: a rapid- and short-acting non-sulfonylurea insulinotropic agent for the treatment of type 2 diabetic patients
96 DrugBank(Pharmacology-Metabolism):Ag-221
97 In vitro metabolism of rivoglitazone, a novel peroxisome proliferator-activated receptor gama agonist, in rat, monkey, and human liver microsomes and freshly isolated hepatocytes. Drug Metab Dispos. 2011 Jul;39(7):1311-9.
98 Excretion and metabolism of lersivirine (5-{[3,5-diethyl-1-(2-hydroxyethyl)(3,5-14C2)-1H-pyrazol-4-yl]oxy}benzene-1,3-dicarbonitrile), a next-generation non-nucleoside reverse transcriptase inhibitor, after administration of [14C]Lersivirine to healthy volunteers. Drug Metab Dispos. 2010 May;38(5):789-800.
99 Pharmacokinetics, metabolism, and excretion of licogliflozin, a dual inhibitor of SGLT1/2, in rats, dogs, and humans
100 Identification and preliminary characterization of UDP-glucuronosyltransferases catalyzing formation of ethyl glucuronide. Anal Bioanal Chem. 2014 Apr;406(9-10):2325-32.
101 Metabolic Profiling of the Novel Hypoxia-Inducible Factor 2 Inhibitor PT2385 In Vivo and In Vitro
102 Human metabolism of nebicapone (BIA 3-202), a novel catechol-o-methyltransferase inhibitor: characterization of in vitro glucuronidation
103 Clinical pharmacokinetics and pharmacogenetics of tamoxifen and endoxifen
104 Evaluation of the Pharmacokinetic Interaction Between the Voltage- and Use-Dependent Nav1.7 Channel Blocker Vixotrigine and Carbamazepine in Healthy Volunteers
105 Bevirimat: a novel maturation inhibitor for the treatment of HIV-1 infection. Antivir Chem Chemother. 2008;19(3):107-13.
106 Preclinical discovery of candidate genes to guide pharmacogenetics during phase I development: the example of the novel anticancer agent ABT-751. Pharmacogenet Genomics. 2013 Jul;23(7):374-81.
107 Preclinical factors affecting the interindividual variability in the clearance of the investigational anti-cancer drug 5,6-dimethylxanthenone-4-acetic acid. Biochem Pharmacol. 2003 Jun 1;65(11):1853-65.
108 Induction and inhibition of cicletanine metabolism in cultured hepatocytes and liver microsomes from rats. Fundam Clin Pharmacol. 2000 Sep-Oct;14(5):509-18.
109 Differential glucuronidation of bile acids, androgens and estrogens by human UGT1A3 and 2B7
110 Metabolic map and bioactivation of the anti-tumour drug noscapine
111 In Vitro Metabolic Pathways of the New Anti-Diabetic Drug Evogliptin in Human Liver Preparations
112 Human uridine diphosphate-glucuronosyltransferase UGT2B7 conjugates mineralocorticoid and glucocorticoid metabolites. Endocrinology. 2003 Jun;144(6):2659-68.
113 Evaluation of the transport, in vitro metabolism and pharmacokinetics of Salvinorin A, a potent hallucinogen. Eur J Pharm Biopharm. 2009 Jun;72(2):471-7.
114 Chemical and enzyme-assisted syntheses of norbuprenorphine-3--D-glucuronide
115 Metabolism, pharmacokinetics, and protein covalent binding of radiolabeled MaxiPost (BMS-204352) in humans
116 Interindividual variability in nicotine metabolism: C-oxidation and glucuronidation
117 4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK) metabolism-related enzymes gene polymorphisms, NNK metabolites levels and urothelial carcinoma
118 Expression of UGT2B7, a UDP-glucuronosyltransferase implicated in the metabolism of 4-hydroxyestrone and all-trans retinoic acid, in normal human breast parenchyma and in invasive and in situ breast cancers
119 Product characteristics of Triumeq
120 Disposition of asciminib, a potent BCR-ABL1 tyrosine kinase inhibitor, in healthy male subjects
121 DrugBank(Pharmacology-Metabolism)Acemetacin
122 [Comparative metabolic studies on [14C]-labelled acemetacin and indometacin in rats (author's transl)] Arzneimittelforschung. 1980;30(8A):1384-91.
123 Effect of ketoconazole on the pharmacokinetic profile of ambrisentan. J Clin Pharmacol. 2009 Jun;49(6):719-24.
124 Pharmacokinetics, metabolism, and excretion of the antiviral drug arbidol in humans
125 Metabolic profile, enzyme kinetics, and reaction phenotyping of -lapachone metabolism in human liver and intestine in vitro
126 DrugBank(Pharmacology-Metabolism)Artenimol
127 Predicting pharmacokinetics and drug interactions in patients from in vitro and in vivo models: the experience with 5,6-dimethylxanthenone-4-acetic acid (DMXAA), an anti-cancer drug eliminated mainly by conjugation. Drug Metab Rev. 2002 Nov;34(4):751-90.
128 Dailymed:Bicalutamide
129 Amide N-glucuronidation of MaxiPost catalyzed by UDP-glucuronosyltransferase 2B7 in humans
130 Metabolic disposition of 14C-bromfenac in healthy male volunteers J Clin Pharmacol. 1998 Aug;38(8):744-52. doi: 10.1002/j.1552-4604.1998.tb04815.x.
131 In vitro metabolism study of buprenorphine: evidence for new metabolic pathways. Drug Metab Dispos. 2005 May;33(5):689-95.
132 Interaction between buprenorphine and norbuprenorphine in neonatal opioid withdrawal syndrome. Drug Alcohol Depend. 2023 Jun 21;249:110832. doi: 10.1016/j.drugalcdep.2023.110832.
133 Determination of buprenorphine, norbuprenorphine, naloxone, and their glucuronides in urine by liquid chromatography-tandem mass spectrometry. Drug Test Anal. 2021 Sep;13(9):1658-1667. doi: 10.1002/dta.3104.
134 Glucuronidation of capsaicin by liver microsomes and expressed UGT enzymes: reaction kinetics, contribution of individual enzymes and marked species differences Expert Opin Drug Metab Toxicol. 2014 Oct;10(10):1325-36. doi: 10.1517/17425255.2014.954548.
135 Carbamazepine and its metabolites in human perfused placenta and in maternal and cord blood Epilepsia. 1995 Mar;36(3):241-8. doi: 10.1111/j.1528-1157.1995.tb00991.x.
136 The pharmacokinetics and metabolism of 14C-carprofen in man Biopharm Drug Dispos. 1982 Jan-Mar;3(1):29-38. doi: 10.1002/bdd.2510030105.
137 Metabolism of carvedilol in dogs, rats, and mice Drug Metab Dispos. 1998 Oct;26(10):958-69.
138 Mass Balance, Metabolism, and Excretion of Cenobamate, a New Antiepileptic Drug, After a Single Oral Administration in Healthy Male Subjects Eur J Drug Metab Pharmacokinet. 2020 Aug;45(4):513-522. doi: 10.1007/s13318-020-00615-7.
139 Microsomal codeine N-demethylation: cosegregation with cytochrome P4503A4 activity
140 Pharmacokinetics and metabolism of codeine in humans
141 Pharmacogenetics of analgesic drugs
142 Diclofenac does not interact with codeine metabolism in vivo: a study in healthy volunteers
143 DrugBank(Pharmacology-Metabolism):Codeine
144 Metabolism of the trisubstituted purine cyclin-dependent kinase inhibitor seliciclib (R-roscovitine) in vitro and in vivo. Drug Metab Dispos. 2008 Mar;36(3):561-70.
145 #N/A
146 Dabigatran Acylglucuronide, the Major Metabolite of Dabigatran, Shows a Weaker Anticoagulant Effect than Dabigatran
147 LC-MS/MS analysis of dextromethorphan metabolism in human saliva and urine to determine CYP2D6 phenotype and individual variability in N-demethylation and glucuronidation J Chromatogr B Analyt Technol Biomed Life Sci. 2004 Dec 25;813(1-2):217-25. doi: 10.1016/j.jchromb.2004.09.040.
148 Classics in Chemical Neuroscience: Dextromethorphan (DXM). ACS Chem Neurosci. 2023 Jun 21;14(12):2256-2270. doi: 10.1021/acschemneuro.3c00088.
149 Physiologically based pharmacokinetic (PBPK) modeling of the role of CYP2D6 polymorphism for metabolic phenotyping with dextromethorphan. Front Pharmacol. 2022 Oct 24;13:1029073. doi: 10.3389/fphar.2022.1029073.
150 Physiologically-based pharmacokinetic modeling of dextromethorphan to investigate interindividual variability within CYP2D6 activity score groups. CPT Pharmacometrics Syst Pharmacol. 2022 Apr;11(4):494-511. doi: 10.1002/psp4.12776.
151 DrugBank(Pharmacology-Metabolism)Diclofenac sodium
152 Pharmacokinetics of dihydrocodeine and its active metabolite after single and multiple oral dosing. Br J Clin Pharmacol. 1999 Sep;48(3):317-22.
153 Pharmacokinetics, Pharmacodynamics and Clinical Use of SGLT2 Inhibitors in Patients with Type 2 Diabetes Mellitus and Chronic Kidney Disease
154 Pharmacokinetics of epirubicin after intravenous administration: experimental and clinical aspects
155 Pharmacokinetics, metabolism, and excretion of the antidiabetic agent ertugliflozin (PF-04971729) in healthy male subjects Drug Metab Dispos. 2013 Feb;41(2):445-56. doi: 10.1124/dmd.112.049551.
156 Bioequivalence Study of Ezetimibe Tablets After a Single Oral Dose of 10?mg in Healthy Japanese Subjects Under Fasting Conditions. Clin Pharmacol Drug Dev. 2023 Apr 6. doi: 10.1002/cpdd.1245.
157 Pharmacokinetics and bioequivalence of Ezetimibe tablet versus Ezetrol?:an open-label, randomized, two-sequence crossover study in healthy Chinese subjects. BMC Pharmacol Toxicol. 2023 Feb 3;24(1):7. doi: 10.1186/s40360-023-00649-y.
158 Investigation of the discriminatory ability of analytes for the bioequivalence assessment of ezetimibe: Parent drug, metabolite, total form, and combination of parent drug and total form. Eur J Pharm Sci. 2022 Jul 1;174:106192. doi: 10.1016/j.ejps.2022.106192.
159 Fevipiprant has a low risk of influencing co-medication pharmacokinetics: Impact on simvastatin and rosuvastatin in different SLCO1B1 genotypes
160 Investigation into UDP-glucuronosyltransferase (UGT) enzyme kinetics of imidazole- and triazole-containing antifungal drugs in human liver microsomes and recombinant UGT enzymes. Drug Metab Dispos. 2010 Jun;38(6):923-9.
161 DrugBank(Pharmacology-Metabolism):Flurbiprofen
162 Mass balance and metabolism of [(3)H]Formoterol in healthy men after combined i.v. and oral administration-mimicking inhalation Drug Metab Dispos. 1999 Oct;27(10):1104-16.
163 DrugBank : Formoterol
164 Intracellular pharmacokinetics of gemcitabine, its deaminated metabolite 2',2'-difluorodeoxyuridine and their nucleotides Br J Clin Pharmacol. 2018 Jun;84(6):1279-1289. doi: 10.1111/bcp.13557.
165 Hydromorphone
166 Opioid pharmacokinetic drug-drug interactions. Am J Manag Care. 2011 Sep;17 Suppl 11:S276-87.
167 Herb-drug interaction in the protective effect of Alpinia officinarum against gastric injury induced by indomethacin based on pharmacokinetic, tissue distribution and excretion studies in rats. J Pharm Anal. 2021 Apr;11(2):200-209. doi: 10.1016/j.jpha.2020.05.009.
168 Identification and structural characterization of in vivo metabolites of ketorolac using liquid chromatography electrospray ionization tandem mass spectrometry (LC/ESI-MS/MS) J Mass Spectrom. 2012 Jul;47(7):919-31. doi: 10.1002/jms.3043.
169 Pregnancy-Related Hormones Increase UGT1A1-Mediated Labetalol Metabolism in Human Hepatocytes Front Pharmacol. 2021 Apr 15;12:655320. doi: 10.3389/fphar.2021.655320.
170 #N/A
171 Effect of the UGT2B15 genotype on the pharmacokinetics, pharmacodynamics, and drug interactions of intravenous lorazepam in healthy volunteers. Clin Pharmacol Ther. 2005 Jun;77(6):486-94.
172 Clinical pharmacokinetics of losartan. Clin Pharmacokinet. 2005;44(8):797-814.
173 Identification of sulfonyl-loxoprofen as novel phase 2 conjugate in rat
174 The potent inhibition of human cytosolic sulfotransferase 1A1 by 17-ethinylestradiol is due to interactions with isoleucine 89 on loop 1 Horm Mol Biol Clin Investig. 2014 Dec;20(3):81-90. doi: 10.1515/hmbci-2014-0028.
175 Presence of morphine metabolites in human cerebrospinal fluid after intracerebroventricular administration of morphine
176 Glucuronidation of anti-HIV drug candidate bevirimat: identification of human UDP-glucuronosyltransferases and species differences
177 Identification of the UDP-glucuronosyltransferase isoforms involved in mycophenolic acid phase II metabolism. Drug Metab Dispos. 2005 Jan;33(1):139-46.
178 Pharmacokinetics of mycophenolic acid and its phenolic-glucuronide and ACYl glucuronide metabolites in stable thoracic transplant recipients
179 Isolation of a novel morphinan 3-O-diglucuronide metabolite from dog urine
180 Optimization of Mass Spectrometry Imaging for Drug Metabolism and Distribution Studies in the Zebrafish Larvae Model: A Case Study with the Opioid Antagonist Naloxone
181 Pharmacokinetics, pharmacodynamics and tolerability of opicapone, a novel catechol-O-methyltransferase inhibitor, in healthy subjects: prediction of slow enzyme-inhibitor complex dissociation of a short-living and very long-acting inhibitor
182 Metabolic fate of pitavastatin, a new inhibitor of HMG-CoA reductase: human UDP-glucuronosyltransferase enzymes involved in lactonization. Xenobiotica. 2003 Jan;33(1):27-41.
183 In vivo metabolic investigation of silodosin using UHPLC-QTOF-MS/MS and in silico toxicological screening of its metabolites J Mass Spectrom. 2016 Oct;51(10):867-882. doi: 10.1002/jms.3795.
184 Simvastatin Tablet, Film-Coated
185 On the Molecular Basis Underlying the Metabolism of Tapentadol Through Sulfation Eur J Drug Metab Pharmacokinet. 2017 Oct;42(5):793-800. doi: 10.1007/s13318-016-0392-8.
186 A case report on fatal intoxication by tapentadol: Study of distribution and metabolism Forensic Sci Int. 2021 Jul;324:110825. doi: 10.1016/j.forsciint.2021.110825.
187 Absorption, metabolism, and excretion of [14C]vildagliptin, a novel dipeptidyl peptidase 4 inhibitor, in humans
188 Disposition of vildagliptin, a novel dipeptidyl peptidase 4 inhibitor, in rats and dogs
189 Stability studies of vorinostat and its two metabolites in human plasma, serum and urine
190 Uridine 5'-diphospho-glucuronosyltransferase genetic polymorphisms and response to cancer chemotherapy. Future Oncol. 2010 Apr;6(4):563-85.
191 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
192 Metabolism and pharmacokinetics of the combination Zidovudine plus Lamivudine in the adult Erythrocebus patas monkey determined by liquid chromatography-tandem mass spectrometric analysis

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.