Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0020)
DME Name	Cytochrome P450 2B6 (CYP2B6), Homo sapiens
Synonyms	Cytochrome P450 family 2 subfamily B member 6; Cytochrome P450 IIB1; CYP2B6; CYPIIB6
Gene Name	CYP2B6
UniProt ID	CP2B6_HUMAN
Gene ID	1555
EC Number	EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) Oxidoreductase Oxygen paired donor oxidoreductase Flavin/flavoprotein donor oxidoreductase EC: 1.14.14.1
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI PPTYQIRFLPR
Structure	3QU8 ; 3UA5 ; 4I91 ; 4RQL ; 4RRT ; 4ZV8 ; 5UAP ; 5UDA ; 5UEC
Pathway	Arachidonic acid metabolism (hsa00590 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Retinol metabolism (hsa00830 )
Function	This enzyme is involved in the metabolism of endocannabinoids and steroids. It catalyzes the epoxidation of double bonds of arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15- epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs). It hydroxylates steroid hormones, including testosterone at C-16 and estrogens at C-2 and plays a role in the oxidative metabolism of xenobiotics, including plant lipids and drugs.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 106 Drugs
Thalidomide	Drug Info	Approved	Breast cancer	ICD11: 2C60	[1]
Bupropion	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[2]
Tamoxifen citrate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[3]
Estrone	Drug Info	Approved	Menopausal disorder	ICD11: GA30	[4]
Nicotine	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[5]
Diclofenac sodium	Drug Info	Approved	Osteoarthritis	ICD11: FA00	[6]
Hydrocodone	Drug Info	Approved	Pain	ICD11: MG30-MG3Z	[7]
Amlodipine besylate	Drug Info	Approved	Essential hypertension	ICD11: BA00	[8]
Fospropofol disodium	Drug Info	Approved	Monitored anaesthesia care	ICD11: N.A.	[9]
Lidocaine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[10]
Brivaracetam	Drug Info	Approved	Focal seizure	ICD11: 8A68	[11]
Cannabidiol	Drug Info	Approved	Lennox-Gastaut syndrome	ICD11: 8A62	[12]
Capsaicin	Drug Info	Approved	Herpes zoster	ICD11: 1E91	[13]
Ifosfamide	Drug Info	Approved	Lung cancer	ICD11: 2C25	[14]
Terbinafine hydrochloride	Drug Info	Approved	Pityriasis versicolor	ICD11: 1F2D	[15]
Ticlopidine	Drug Info	Approved	Cerebral stroke	ICD11: 8B11	[16]
Tretinoin	Drug Info	Approved	Acne vulgaris	ICD11: ED80	[17]
Valproic acid	Drug Info	Approved	Epilepsy	ICD11: 8A60	[10]
Disulfiram	Drug Info	Approved	Alcohol dependence	ICD11: 6C40	[18]
Ixazomib	Drug Info	Approved	Amyloidosis	ICD11: 5D00	[19]
Methyltestosterone	Drug Info	Approved	Breast cancer	ICD11: 2C60	[20]
Apomorphine	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[21]
Clomiphene citrate	Drug Info	Approved	Female infertility	ICD11: GA31	[22]
Halothane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[23]
Hydrocodone bitartrate	Drug Info	Approved	Neuropathic pain	ICD11: 8E43	[24]
Ketamine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[25]
Meperidine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[10]
Perampanel	Drug Info	Approved	Focal seizure	ICD11: 8A68	[26]
Arteether	Drug Info	Approved	Malaria	ICD11: 1F40-1F45	[27]
Benzphetamine	Drug Info	Approved	Obesity	ICD11: 5B81	[28]
Cisapride	Drug Info	Approved	Gastro-oesophageal reflux disease	ICD11: DA22	[29]
Dextromethorphan hydrobromide	Drug Info	Approved	Atherosclerosis	ICD11: BA80	[30]
Diazepam	Drug Info	Approved	Epilepsy	ICD11: 8A60	[31]
Lorcaserin	Drug Info	Approved	Obesity	ICD11: 5B81	[32]
Nevirapine	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[33]
Verapamil hydrochloride	Drug Info	Approved	Essential hypertension	ICD11: BA00	[17]
Amitriptyline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[34]
Artemether	Drug Info	Approved	Malaria	ICD11: 1F40	[10]
Bromfenac	Drug Info	Approved	Cataract	ICD11: 9B10	[35]
Carbamazepine	Drug Info	Approved	Epilepsy	ICD11: 8A60	[36]
Cenobamate	Drug Info	Approved	Focal seizure	ICD11: 8A68	[37]
Clobazam	Drug Info	Approved	Lennox-Gastaut syndrome	ICD11: 8A62	[38]
Cyclophosphamide	Drug Info	Approved	Multiple myeloma	ICD11: 2A83	[39]
Efavirenz	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[40]
Fluoxetine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[41]
Imipramine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[42]
Isotretinoin	Drug Info	Approved	Acne vulgaris	ICD11: ED80	[43]
Istradefylline	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[44]
Midazolam hydrochloride	Drug Info	Approved	Anxiety disorder	ICD11: 6B00	[45]
Phenytoin	Drug Info	Approved	Epilepsy	ICD11: 8A60	[46]
Ropivacaine hydrochloride	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[17]
Exemestane	Drug Info	Approved	Breast cancer	ICD11: 2C60	[47]
Loxapine succinate	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[48]
Malathion	Drug Info	Approved	Pediculosis	ICD11: 1G00	[49]
Ospemifene	Drug Info	Approved	Dyspareunia	ICD11: GA12	[50]
Propofol	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[51]
Ritonavir	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[40]
Testosterone undecanoate	Drug Info	Approved	Hypogonadism	ICD11: 5A61	[10]
Tramadol hydrochloride	Drug Info	Approved	Neuropathic pain	ICD11: 8E43	[52]
Triclosan	Drug Info	Approved	Malaria	ICD11: 1F40-1F45	[53]
Vortioxetine hydrobromide	Drug Info	Approved	Depression	ICD11: 6A71	[54]
Benzocaine	Drug Info	Approved	Anaesthesia	ICD11: 9A76-9A78	[55]
Irinotecan hydrochloride	Drug Info	Approved	Colon cancer	ICD11: 2B90	[56]
Lenvatinib	Drug Info	Approved	Thyroid cancer	ICD11: 2D10	[57]
Levomethadyl acetate hydrochloride	Drug Info	Approved	Opiate dependence	ICD11: 6C43	[58]
Loperamide hydrochloride	Drug Info	Approved	Irritable bowel syndrome	ICD11: DD91	[59]
Methadone	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[60]
Mexiletine hydrochloride	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[61]
Olopatadine	Drug Info	Approved	Conjunctivitis	ICD11: 9A60	[62]
Phenobarbital	Drug Info	Approved	Epilepsy	ICD11: 8A60	[36]
Promethazine	Drug Info	Approved	Functional nausea/vomiting	ICD11: DD90	[23]
Timolol maleate	Drug Info	Approved	Essential hypertension	ICD11: BA00	[63]
Azilsartan	Drug Info	Approved	Hypertension	ICD11: BA00-BA04	[64]
Azilsartan	Drug Info	Approved	Hypertension	ICD11: BA00-BA04	[65], [66]
Azilsartan medoxomil	Drug Info	Approved	Essential hypertension	ICD11: BA00	[67]
Clofibrate	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[68]
Clopidogrel bisulfate	Drug Info	Approved	Acute coronary syndrome	ICD11: BA4Z	[69]
Flibanserin	Drug Info	Approved	Inhibited sexual desire	ICD11: HA00	[70]
Levomethadyl Acetate	Drug Info	Approved	Opiate dependence	ICD11: 6C43	[71]
Lomitapide mesylate	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[72]
Loratadine	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[73]
Mephenytoin	Drug Info	Approved	Epilepsy	ICD11: 8A60	[16]
Moxidectin	Drug Info	Approved	Onchocerciasis	ICD11: 1F6A	[74]
Prasugrel hydrochloride	Drug Info	Approved	Acute coronary syndrome	ICD11: BA4Z	[75]
Selegiline	Drug Info	Approved	Major depressive disorder	ICD11: 6A70-6A7Z	[76]
Selegiline hydrochloride	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[77]
Sertraline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[78]
Temazepam	Drug Info	Approved	Insomnia	ICD11: 7A00	[79]
Voxelotor	Drug Info	Approved	Sickle-cell anaemia	ICD11: 3A51	[80]
Desipramine	Drug Info	Approved	Attention deficit hyperactivity disorder	ICD11: 6A05	[56]
Enasidenib	Drug Info	Approved	Acute myeloid leukaemia	ICD11: 2A60	[81]
Epinastine	Drug Info	Approved	Conjunctivitis	ICD11: 9A60	[82]
Ibudilast	Drug Info	Approved	Castleman's disease	ICD11: 4B2Y	[83]
Isoflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[17]
Meloxicam	Drug Info	Approved	Osteoarthritis	ICD11: FA00	[84]
Permethrin	Drug Info	Approved	Scabies	ICD11: 1G04	[85]
Rifampicin	Drug Info	Approved	Osteoporosis	ICD11: FB83	[86]
Romidepsin	Drug Info	Approved	Cutaneous T-cell lymphoma	ICD11: 2B01	[87]
Sevoflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[17]
Testosterone cypionate	Drug Info	Approved	Testosterone deficiency	ICD11: 5A81	[10]
Testosterone enanthate	Drug Info	Approved	Testosterone deficiency	ICD11: 5A81	[10]
Velpatasvir	Drug Info	Approved	Viral hepatitis	ICD11: 1E51	[88]
Velpatasvir	Drug Info	Approved	Viral hepatitis	ICD11: 1E51	[89]
Methoxyflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[90]
Testosterone	Drug Info	Approved	Osteoporosis	ICD11: FB83	[45]
Trifarotene	Drug Info	Approved	Acne vulgaris	ICD11: ED80	[91]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 9 Drugs
Artemisinin	Drug Info	Phase 4	Malaria	ICD11: 1F40	[92]
Cinnarizine	Drug Info	Phase 4	Haemorrhagic stroke	ICD11: 8B20	[16]
Ketobemidone	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[93]
Mianserin	Drug Info	Phase 4	Depression	ICD11: 6A71	[23]
Vonoprazan	Drug Info	Phase 4	Gastro-oesophageal reflux disease	ICD11: DA22	[94]
Vonoprazan	Drug Info	Phase 4	Gastro-oesophageal reflux disease	ICD11: DA22	[95]
Zotepine	Drug Info	Phase 4	Schizophrenia	ICD11: 6A20	[96]
Clotiazepam	Drug Info	Phase 4	Anxiety disorder	ICD11: 6B00	[97]
Flunitrazepam	Drug Info	Phase 4	Insomnia	ICD11: 7A00	[98]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 13 Drugs
BMS-650032	Drug Info	Phase 3	Viral hepatitis	ICD11: 1E51	[99]
KW-5338	Drug Info	Phase 3	Gastroparesis	ICD11: DA41	[100]
BMS-986165	Drug Info	Phase 3	Psoriasis vulgaris	ICD11: EA90	[101]
LY-450139	Drug Info	Phase 3	Alzheimer disease	ICD11: 8A20	[102]
WSM-3978G	Drug Info	Phase 3	Hypertrophic cardiomyopathy	ICD11: BC43	[103]
CR-2017	Drug Info	Phase 3	Irritable bowel syndrome	ICD11: DD91	[104]
Fenfluramine	Drug Info	Phase 3	Dravet syndrome	ICD11: 8A61-8A6Z	[105]
TAK-491	Drug Info	Phase 3	Hypertension	ICD11: BA00-BA04	[106]
Ganaxolone	Drug Info	Phase 3	Complex partial seizure	ICD11: 8A61-8A6Z	[107]
JNJ-54135419	Drug Info	Phase 3	Depression	ICD11: 6A71	[25]
MRTX849	Drug Info	Phase 3	Lung cancer	ICD11: 2C25	[108]
WY-1485	Drug Info	Phase 3	Haemorrhagic stroke	ICD11: 8B20	[17]
Ag-221	Drug Info	Phase 3	Acute myelogenous leukaemia	ICD11: 2A41	[109]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 8 Drugs
Fexinidazole	Drug Info	Phase 2/3	Trypanosomiasis	ICD11: 1D51-1F53	[110], [111]
Fexinidazole	Drug Info	Phase 2/3	Trypanosomiasis	ICD11: 1D51-1F53	[111]
HOE-239	Drug Info	Phase 2/3	Trypanosomiasis	ICD11: 1F51	[111]
CYC-202	Drug Info	Phase 2	Lung cancer	ICD11: 2C25	[112]
Z-4828	Drug Info	Phase 2	Histiocytic sarcoma	ICD11: 2B31	[113]
Piclamilast	Drug Info	Phase 2	Rheumatoid arthritis	ICD11: FA20	[114]
TAK-906	Drug Info	Phase 2	Gastroparesis	ICD11: DA41	[115]
Encequidar	Drug Info	Phase 2	Metastatic breast cancer	ICD11: 2C60-2C6Y	[116]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 2 Drugs
H3B-6545	Drug Info	Phase 1	Breast cancer	ICD11: 2C60	[117]
OSI-930	Drug Info	Phase 1	Solid tumour/cancer	ICD11: 2A00-2F9Z	[118]
Discontinued/withdrawn Drugs			Click to Show/Hide the Full List of Drugs: 7 Drugs
Almokalant	Drug Info	Discontinued in Phase 3	Cardiac arrhythmias	ICD11: BC9Z	[119]
AZD0328	Drug Info	Discontinued in Phase 2	Alzheimer disease	ICD11: 8A20	[120]
TAK-802	Drug Info	Discontinued in Phase 2	Urinary dysfunction	ICD11: GC2Z	[121]
Nomifensine	Drug Info	Discontinued	Depression	ICD11: 6A71	[122]
ABT-001	Drug Info	Discontinued	Asthma	ICD11: CA23	[16]
DEA-2250	Drug Info	Discontinued	Epilepsy	ICD11: 8A60	[123]
AN-16649	Drug Info	Discontinued	Acute lymphoblastic leukemia	ICD11: 2B33	[124]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 7 Drugs
Coumarin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[125], [126]
Ethylmorphine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[31]
Flavone	Drug Info	Investigative	Colon cancer	ICD11: 2B90	[127]
Antipyrine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[128]
Beta-ionone	Drug Info	Investigative	Breast cancer	ICD11: 2C60	[129]
Lauric acid	Drug Info	Investigative	Alzheimer disease	ICD11: 8A20	[130], [131]
Levoverbenone	Drug Info	Investigative	Pulmonary tuberculosis	ICD11: 1B10	[132]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR009416	Almokalant	Almokalant Metabolite M13	Oxidation - Sulfoxidation	Almokalant	[119]
MR004542	AN-16649	AQ4	Unclear - Unclear	AN-16649	[133], [134], [135]
MR000256	Apomorphine	Norapomorphine	Oxidation - N-Demethylation	Apomorphine	[21]
MR012560	Arecaidine	N-methylnipecotic acid	Unclear - Unclear	Arecoline	[136]
MR008681	Arteether	Dihydroqinghaosu (DQHS)	Oxidation - Deethylation	Arteether	[27], [137]
MR000298	Artemether	Dihydroartemisinin	Oxidation - Oxidation	Artemether	[138]
MR000300	Artemether	Alpha-dihydroartemisinin	Unclear - Unclear	Artemether	[139]
MR000301	Artemether	Deoxyartemsinin	Unclear - Unclear	Artemether	[139]
MR000302	Artemether	Deoxydihydro-artemisinin	Unclear - Unclear	Artemether	[139]
MR007278	AV-650	Unclear	Unclear - Unclear	AV-650	[140]
MR009369	AZD0328	AZD0328 Metabolite M6	Oxidation - N-oxidation	AZD0328	[120]
MR008917	Azilsartan	Azilsartan M-I	Reduction - Decarboxylation	Azilsartan	[64]
MR013088	Azilsartan	Azilsartan M-	Oxidation - O-dealkylation	Azilsartan medoxomil	[67]
MR008758	Benzocaine	Benzocaine hydroxylamine	Oxidation - N-hydroxylation	Benzocaine	[55]
MR007554	Beta-ionone	(+)-(S)-4-hydroxy--ionone	Oxidation - 4S-hydroxylation	Beta-ionone	[129]
MR011144	BMS-201038	Lomitapide Metabolite M1	Oxidation - N-dealkylation	BMS-201038	[141]
MR005473	BMS-986165	Deucravacitinib M11 metabolite	Oxidation - Oxidationn	BMS-986165	[142]
MR002552	Brivaracetam	Brivaracetam metabolite M1b	Oxidation - Hydroxylation	Brivaracetam	[11]
MR000458	Bromfenac indolinone	Bromfenac metabolite M3	Unclear - Unclear	Bromfenac	[143], [144]
MR000513	Bupropion	S-hydroxybupropion	Oxidation - Hydroxylation	Bupropion	[145]
MR000513	Bupropion	R-hydroxybupropion	Oxidation - Hydroxylation	Bupropion	[145]
MR002818	Capsaicin	Capsaicin metabolite M1	Oxidation - Dehydrogenation	Capsaicin	[13]
MR002819	Capsaicin	Capsaicin metabolite M2	Oxidation - Omega-Hydroxylation	Capsaicin	[13]
MR002820	Capsaicin	Capsaicin metabolite M3	Oxidation - Omega-1-Hydroxylation	Capsaicin	[13]
MR002821	Capsaicin	Capsaicin metabolite M4	Oxidation - Dehydrogenation	Capsaicin	[13]
MR002822	Capsaicin	Capsaicin metabolite M5M7	Oxidation - Hydroxylation	Capsaicin	[13]
MR002823	Capsaicin	Capsaicin metabolite M6	Oxidation - O-Dehydrogenation	Capsaicin	[13]
MR002824	Capsaicin	Capsaicin metabolite M8	Oxidation - N-Dehydrogenation; Oxygenation	Capsaicin	[13]
MR002825	Capsaicin	Capsaicin metabolite M9	Oxidation - N-Dehydrogenation	Capsaicin	[13]
MR002589	Carbamazepine	3-hydroxycarbamazepine	Oxidation - 3-Hydroxylation	Carbamazepine	[146]
MR013305	Cinnarizine	Cinnarizine metabolite M4	Oxidation - Hydrolyzationn	Cinnarizine	[16]
MR006541	Clobazam	Clobazam Metabolite M9	Unclear - Unclear	Clobazam	[147], [38]
MR006547	Clobazam Metabolite M7	Clobazam Metabolite M5	Unclear - Unclear	Clobazam	[147]
MR008658	(E)-DE-CLOM	(E)-4-OH-DE-CLOM	Unclear - Unclear	Clomiphene citrate	[22]
MR008659	Clomiphene citrate	(E)-4-OH-CLOM	Unclear - Unclear	Clomiphene citrate	[22]
MR006592	2-Oxoclopidogrel	Active Metabolite of Clopidogrel	spontaneous - spontaneous	Clopidogrel bisulfate	[16]
MR006591	Clopidogrel bisulfate	2-Oxoclopidogrel	Oxidation - Oxidationn	Clopidogrel bisulfate	[16]
MR006006	Clotiazepam	Unclear	Unclear - Unclear	Clotiazepam	[97]
MR005309	Coumarin	7-Hydroxycoumarin	Oxidation - Hydroxy Aromaticlation	Coumarin	[125], [126]
MR007436	CYC-202	CYC-202 M7	Unclear - Unclear	CYC-202	[112]
MR012897	Cyclobenzaprine	4-Hydroxycyclophosphamide	Oxidation - 4-hydroxylation	Cyclobenzaprine	[148], [16]
MR009942	Cyclophosphamide	4-Hydroxycyclophosphamide	Unclear - Unclear	Cyclophosphamide	[149]
MR005953	Mephobarbital	Phenobarbital	Unclear - Unclear	DEA-2250	[123]
MR000818	Dextromethorphan hydrobromide	(+)-3-Methoxymorphinan	Oxidation - N-Demethylation	Dextromethorphan hydrobromide	[150], [151]
MR000819	Diazepam	Nordazepam	Oxidation - N-Demethylation	Diazepam	[152], [153], [154]
MR000823	Temazepam	Oxazepam	Oxidation - N-Demethylation	Diazepam	[155], [154]
MR002614	Diclofenac sodium	5-hydroxy diclofenac	Oxidation - 5-Hydroxylation	Diclofenac sodium	[156], [157]
MR000883	Diethyldithiocarbamic acid methyl ester	.	Oxidation - Thiono-Oxidation	Disulfiram	[158]
MR010554	Divalproex sodium	4-ene-VPA	Unclear - Unclear	Divalproex sodium	[16]
MR000903	Efavirenz	8-hydroxy-efavirenz	Oxidation - Hydroxylation	Efavirenz	[159], [160], [161], [162]
MR006867	Enasidenib	AGI-16903	Oxidation - N-dealkylation	Enasidenib	[163]
MR000908	Epinastine	9,13b-dehydroepinastine	Unclear - Unclear	Epinastine	[164]
MR002696	Estrone	2-hydroxyestrone	Oxidation - Hydroxylation	Estrone	[4]
MR001000	Exemestane	6-hydroxymethylandrosta-1,4,6-triene-3,17-dione	Oxidation - Deamination	Exemestane	[165]
MR012196	Fenfluramine	Norfenfluramine	Unclear - Unclear	Fenfluramine	[166]
MR005476	Fexinidazole	Fexinidazole sulfoxide metabolite (M1)	Oxidation - Oxidationn	Fexinidazole	[110], [111]
MR005477	Fexinidazole sulfoxide metabolite (M1)	Fexinidazole sulfone metabolite (M2)	Oxidation - Oxidationn	Fexinidazole	[110], [111]
MR006309	Flavone	6OHF	Unclear - Unclear	Flavone	[127]
MR006310	Flavone	OHFM7	Unclear - Unclear	Flavone	[127]
MR006311	Flavone	OHFM12	Unclear - Unclear	Flavone	[127]
MR006312	Flavone	OHFM11	Unclear - Unclear	Flavone	[127]
MR005012	Fluoxetine hydrochloride	Norfluoxetine	Oxidation - N-demethylation	Fluoxetine hydrochloride	[167], [16], [168], [169]
MR003261	Propofol	4-hydroxypropofol	Oxidation - 4-Hydroxylation	Fospropofol	[16]
MR007835	Propofol	4-Hydroxypropofol	Unclear - Unclear	Fospropofol disodium	[9]
MR011675	Ganaxolone	16-OH ganazolone	Oxidation - Hydroxylation	Ganaxolone	[170]
MR005083	Halothane	2-chloro-1,1-difluoroethene	Reduction - Dehalogenation	Halothane	[17], [171]
MR005084	Halothane	1-chloro-2,2,2-trifluoroethanide	Reduction - Dehalogenation	Halothane	[17], [171]
MR006056	Fexinidazole Sulfone M1	Fexinidazole Sulfone M2	Oxidation - Oxidationn	HOE-239	[110]
MR006055	HOE-239	Fexinidazole Sulfone M1	Oxidation - Oxidationn	HOE-239	[110]
MR005118	6-alpha-hydrocodol	6-alpha-hydromorphol	Oxidation - O-demethylation	Hydrocodone bitartrate	[172]
MR005116	6-beta-hydrocodol	6-beta-hydromorphol	Oxidation - O-demethylation	Hydrocodone bitartrate	[172]
MR005109	Hydrocodone bitartrate	Hydromorphone	Oxidation - O-demethylation	Hydrocodone bitartrate	[173]
MR004650	Ifosfamide	4-Hydroxyifosfamide	Oxidation - 4-hydroxylation	Ifosfamide	[148]
MR004662	Ifosfamide	3-Dechloroethylifosfamide	Unclear - Unclear	Ifosfamide	[167], [148]
MR004663	Ifosfamide	Dechloroethylifosfamide	Unclear - Unclear	Ifosfamide	[148]
MR004660	Ifosfamide	Chloroacetaldehyde	Unclear - Unclear	Ifosfamide	[148], [174]
MR013337	JNJ-54135419	Noresketamine	Oxidation - N-demethylation	JNJ-54135419	[175]
MR001321	Ketamine	Norketamine	Oxidation - N-Demethylation	Ketamine	[25], [176], [177], [178]
MR003687	KW-5338	KW-5338 Metabolite M1	Oxidation - Hydrolyzationn	KW-5338	[179]
MR003688	KW-5338	KW-5338 Metabolite M3	Oxidation - Hydrolyzationn	KW-5338	[179]
MR003689	KW-5338	KW-5338 Metabolite M4	Oxidation - Hydrolyzationn	KW-5338	[179]
MR003691	KW-5338	KW-5338 Metabolite M2	Oxidation - Hydrolyzationn	KW-5338	[179]
MR005371	Lauric acid	11-hydroxylauric acid	Oxidation - Hydrolyzationn	Lauric acid	[131]
MR005368	Lauric acid	12-Hydroxydodecanoic Acid	Oxidation - Aliphatic hydroxylation	Lauric acid	[130], [131]
MR005372	Lauric acid	2-hydroxylauric acid	Oxidation - Hydrolyzationn	Lauric acid	[131]
MR010933	Lenvatinib	O-demethyl Lenvatinib	Unclear - Unclear	Lenvatinib	[57]
MR010934	Lenvatinib	N-descyclopropyl lenvatinib	Unclear - Unclear	Lenvatinib	[57]
MR008028	Levomethadyl Acetate	Nor-levomethadyl acetate (nor-LAAM)	Oxidation - N-demethylation	Levomethadyl Acetate	[148], [71]
MR005376	Levoverbenone	(-)-10-OH Verbenone	Oxidation - Hydrolyzationn	Levoverbenone	[132]
MR001555	Lidocaine	.	Unclear - Unclear	Lidocaine	[10]
MR006893	Lomitapide mesylate	Lomitapide metabolite M1	Other reaction - Cleavage	Lomitapide mesylate	[72]
MR006894	Lomitapide mesylate	Lomitapide metabolite M3	Unclear - Unclear	Lomitapide mesylate	[72]
MR006895	Loperamide hydrochloride	N-demethyl loperamide	Oxidation - N-demethylation	Loperamide hydrochloride	[59]
MR006906	Lorcaserin	N-hydroxylorcaserin	Oxidation - Hydrolyzationn	Lorcaserin	[32]
MR006925	Loxapine succinate	Loxapine N-oxide	Oxidation - Oxidationn	Loxapine succinate	[48]
MR006926	Loxapine succinate	7-Hydroxyloxapine	Oxidation - Oxidationn	Loxapine succinate	[48]
MR003762	LY-450139	LY-2484595 Metabolite M3	Oxidation - Benzylic hydroxylation	LY-450139	[102]
MR006943	Malathion	Malaoxon	Other reaction - Desulfonization	Malathion	[49]
MR006948	Malathion	Dimethyldithiophosphate	Other reaction - Desulfonization	Malathion	[49]
MR002857	Meloxicam	5-hydroxymethyl meloxicam	Oxidation - Hydroxylation	Meloxicam	[180], [84]
MR013111	Meperidine	Normeperidine	Oxidation - N-demethylation	Meperidine	[181], [182], [183]
MR009971	Mephenytoin	Nirvanol	Oxidation - Demethylation	Mephenytoin	[184], [185]
MR001657	4-formyl-amino-antipyrine (FAA)	4-amino-antipyrine (AA)	Oxidation - N-Demethylation	Metamizole sodium	[186], [187]
MR001655	N-Desmethylaminopyrine	4-amino-antipyrine (AA)	Oxidation - N-Demethylation	Metamizole sodium	[186], [187]
MR009998	Methadone	EDDP	Oxidation - N-demethylation	Methadone	[60], [188]
MR001667	8-hydroxyminaserin	8-hydroxy-N-desmethylmianserin	Oxidation - N-Dealkylation	Mianserin	[189]
MR001673	Mianserin	(R)-mianserin,N-Desmethyl	Oxidation - N-Dealkylation	Mianserin	[189]
MR001669	Mianserin	8-hydroxyminaserin	Oxidation - Hydroxylation	Mianserin	[189]
MR004809	Moxidectin	Monohydroxy metabolite of moxidectin at C29	Oxidation - Hydrolyzationn	Moxidectin	[74]
MR004810	Moxidectin	Monohydroxy metabolite of moxidectin at the C14	Oxidation - Hydrolyzationn	Moxidectin	[74]
MR005404	MRTX849	Unclear	Unclear - Unclear	MRTX849	[190]
MR003382	R-Naftopidil	R-Naftopidil metabolite M1	Unclear - Unclear	Naftopidil	[191], [192]
MR003384	R-Naftopidil	R-Naftopidil metabolite M3	Unclear - Unclear	Naftopidil	[191], [192]
MR003271	Nevirapine	8-hydroxynevirapine	Oxidation - 8-Hydroxylation	Nevirapine	[193]
MR003272	Nevirapine	3-hydroxynevirapine	Oxidation - 3-Hydroxylation	Nevirapine	[193]
MR002960	Nicotine	(S)-Nicotine delta-1',5'-iminium ion	Oxidation - Heteroring Dehydrogenation	Nicotine	[167]
MR002953	Nicotine	Nicotine imine	Unclear - Unclear	Nicotine	[194]
MR007640	Nomifensine	Nomifensine H1	Unclear - Unclear	Nomifensine	[122]
MR007638	Nomifensine	Nomifensine H4	Unclear - Unclear	Nomifensine	[122]
MR007636	Nomifensine	Nomifensinc N-hydroxylamine (H6)	Unclear - Unclear	Nomifensine	[122]
MR001857	Ospemifene	4-hydroxylation Ospemifene	Unclear - Unclear	Ospemifene	[50]
MR002004	Permethrin	Phenoxybenzyl alcohol	Hydrolysis - Hydrolysis	Permethrin	[85], [195]
MR005388	PF-04965842	Abrocitinib M4 metabolite	Oxidation - Oxidationn	PF-04965842	[196]
MR005393	PF-04965842	Abrocitinib M1 metabolite	Oxidation - Oxidationn	PF-04965842	[196]
MR005400	PF-04965842	Abrocitinib M3 metabolite	Oxidation - Oxidationn	PF-04965842	[196]
MR005397	PF-04965842	Abrocitinib M2 metabolite	Oxidation - Oxidationn	PF-04965842	[196]
MR002023	Phenobarbital	4-hydroxyphenobarbital	Oxidation - 4-Hydroxylation	Phenobarbital	[16]
MR002024	Phenobarbital	Mephobarbital	Conjugation - Methylation	Phenobarbital	[197]
MR002030	Hydroxyphenytoin	Phenytoin catechol	Oxidation - Oxidation	Phenytoin	[167]
MR012490	Piclamilast	ADCP	Unclear - Unclear	Piclamilast	[198]
MR002088	R-95913	R-138727	Unclear - Unclear	Prasugrel hydrochloride	[16], [199], [200], [201]
MR002187	Propofol	4-hydroxypropofol	Oxidation - 4-Hydroxylation	Propofol	[16]
MR006596	Romidepsin	Romidepsin metabolite M1	Reduction - Reduction	Romidepsin	[202]
MR010844	Desmethyl selegiline	Amphetamine	Unclear - Unclear	Selegiline	[76]
MR002889	Selegiline hydrochloride	Desmethylselegiline	Oxidation - N-Dealkylation	Selegiline hydrochloride	[203], [204]
MR002247	Sertraline hydrochloride	Desmethylsertraline	Oxidation - N-Demethylation	Sertraline hydrochloride	[205], [206], [207], [208]
MR011373	Azilsartan	TAK-491 Metabolite M1	Reduction - Decarboxylation	TAK-491	[64]
MR009357	TAK-802 Metabolite M-IV	TAK-802 Metabolite M-II	Unclear - Unclear	TAK-802	[121]
MR003526	Tamoxifen citrate	4-hydroxytamoxifen	Oxidation - 4-Hydroxylation	Tamoxifen citrate	[209], [210], [211], [212]
MR002376	O-conjugate of temazepam	Temazepam metabolite M1	Oxidation - Demethylation	Temazepam	[213], [79]
MR002378	Temazepam	Oxazepam	Oxidation - Demethylation	Temazepam	[214], [213]
MR002399	Hydroxyterbinafine	N-Desmethylhydroxyterbinafine	Oxidation - N-Demethylation	Terbinafine hydrochloride	[215], [216]
MR002400	Hydroxyterbinafine	Carboxyterbinafine	Oxidation - Oxidation	Terbinafine hydrochloride	[215]
MR002401	N-Desmethylterbinafine	N-Desmethylhydroxyterbinafine	Oxidation - Hydoxylation	Terbinafine hydrochloride	[215]
MR002402	N-Desmethylterbinafine	N-Desmethylterbinafine dihydrodiol derivative (2)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[215]
MR002403	N-Desmethylterbinafine	N-Desmethylterbinafine dihydrodiol derivative (1)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[215]
MR002406	Terbinafine dihydrodiol derivative (1)	N-Desmethylterbinafine dihydrodiol derivative (1)	Oxidation - N-Demethylation	Terbinafine hydrochloride	[215]
MR002407	Terbinafine dihydrodiol derivative (2)	N-Desmethylterbinafine dihydrodiol derivative (2)	Oxidation - N-Demethylation	Terbinafine hydrochloride	[215]
MR002409	Terbinafine hydrochloride	N-Desmethylterbinafine	Oxidation - N-Demethylation	Terbinafine hydrochloride	[215]
MR002410	Terbinafine hydrochloride	1-Naphthaldehyde	Oxidation - Deamination	Terbinafine hydrochloride	[215]
MR002408	Terbinafine hydrochloride	Hydroxyterbinafine	Oxidation - Hydoxylation	Terbinafine hydrochloride	[215]
MR002411	Terbinafine hydrochloride	Terbinafine dihydrodiol derivative (1)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[215]
MR002412	Terbinafine hydrochloride	Terbinafine dihydrodiol derivative (2)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[215]
MR004987	Ticlopidine	Ticlopidine S-oxide	Unclear - Unclear	Ticlopidine	[16]
MR004993	Ticlopidine	7-Hydroxyticlopidine	Unclear - Unclear	Ticlopidine	[217]
MR004996	M1 metabolite, timolol	Timolol maleate Metabolite M3	Unclear - Unclear	Timolol maleate	[63]
MR003378	N-Desmethyltramadol	N,N-didesmethyltramadol	Oxidation - O-Demethylation	Tramadol hydrochloride	[167]
MR003381	Tramadol hydrochloride	N-Desmethyltramadol	Oxidation - N-Demethylation	Tramadol hydrochloride	[218], [219]
MR009627	4-Hydroxyretinoic acid	4-Oxoretinoic acid	Oxidation - Oxidation	Tretinoin	[220], [221]
MR009636	Tretinoin	18-OH-RA	Oxidation - Hydroxylation	Tretinoin	[220], [221], [43]
MR009626	Tretinoin	4-Hydroxyretinoic acid	Oxidation - 4-hydroxylation	Tretinoin	[220], [43]
MR009629	Tretinoin	5,6-epoxy-RA	Oxidation - Ring epoxidation	Tretinoin	[221], [221], [220]
MR009631	Tretinoin	13-cis RA	Other reaction - Isomerization	Tretinoin	[43], [221]
MR002452	Trifarotene	.	Unclear - Unclear	Trifarotene	[222]
MR002487	2-N-Propyl-4-oxopentanoic acid	2-Propylsuccinic acid	Oxidation - 5-Hydroxylation	Valproic acid	[16]
MR002492	Valproic acid	4-hydroxyvalproic acid	Oxidation - 4-Hydroxylation	Valproic acid	[16]
MR002494	Valproic acid	5-hydroxyvalproic acid	Oxidation - 5-Hydroxylation	Valproic acid	[16]
MR002493	Valproic acid	4-ene-Valproic acid	Oxidation - 3-Hydroxylation	Valproic acid	[16]
MR002505	Velpatasvir	Desmethyl-velpatasvir	Oxidation - O-Demethylation	Velpatasvir	[223]
MR013079	Vonoprazan	N-demethylated TAK-438	Oxidation - N-demethylation	Vonoprazan	[95], [94]
MR013073	Vonoprazan	Vonoprazan M-	Unclear - Unclear	Vonoprazan	[224], [94]
MR013080	Vonoprazan	Vonoprazan M-	Unclear - Unclear	Vonoprazan	[224], [94]
MR005673	Vortioxetine hydrobromide	Vortioxetine Metabolite 2	Oxidation - Hydrolyzationn	Vortioxetine hydrobromide	[54], [225]
MR005675	Voxelotor	Unclear	Oxidation - Oxidationn	Voxelotor	[226]
MR006491	WSM-3978G	Monohydroxyperhexiline	Oxidation - Hydrolyzationn	WSM-3978G	[103]
MR006492	WSM-3978G	Trans-hydroxyperhexilline	Oxidation - Aliphatic hydroxylation	WSM-3978G	[103]
MR006490	WSM-3978G	Cis-Hydroxy Perhexiline	Oxidation - Hydrolyzationn	WSM-3978G	[103]
MR006493	WY-1485	NLA-715	Oxidation - Hydrolyzationn	WY-1485	[227], [17]
MR006071	Z-4828	L-ifosfamide	Oxidation - Aliphatic hydroxylation	Z-4828	[228]
MR006072	Z-4828	Ifosfamide	Oxidation - N-dealkylation	Z-4828	[228]
MR006073	Z-4828	L-cyclophosphamide	Oxidation - N-dealkylation	Z-4828	[228]
MR013081	Zotepine	Norzotepine	Oxidation - N-demethylation	Zotepine	[189], [229]
MR013084	Zotepine	3-OH-zotepine	Oxidation - Aromatic hydroxylation	Zotepine	[189]


⏷ Show the Full List of 183 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.84E-01; Fold-change: 2.08E-02; Z-score: 7.58E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.05E-02; Fold-change: 3.08E-01; Z-score: 2.67E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.60E-02; Fold-change: 1.65E-01; Z-score: 8.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.42E-11; Fold-change: 1.25E-01; Z-score: 7.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.96E-03; Fold-change: -1.55E-01; Z-score: -1.47E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.43E-01; Fold-change: 1.84E-02; Z-score: 5.34E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.52E-01; Fold-change: -9.47E-03; Z-score: -5.16E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.78E-02; Fold-change: 4.13E-02; Z-score: 1.93E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.41E-01; Fold-change: -4.80E-02; Z-score: -3.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.69E-05; Fold-change: -5.35E-01; Z-score: -2.88E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.27E-03; Fold-change: -3.02E-01; Z-score: -1.04E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.66E-01; Fold-change: -2.64E-02; Z-score: -2.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.18E-01; Fold-change: -3.02E-02; Z-score: -2.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.02E-01; Fold-change: 1.35E-02; Z-score: 7.95E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.95E-02; Fold-change: -1.70E-01; Z-score: -1.64E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.81E-01; Fold-change: -4.25E-02; Z-score: -1.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.01E-01; Fold-change: 5.77E-02; Z-score: 8.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.88E-03; Fold-change: -6.19E-01; Z-score: -1.74E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.30E-02; Fold-change: -1.59E-02; Z-score: -1.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.41E-01; Fold-change: -4.49E-02; Z-score: -1.67E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.56E-01; Fold-change: -6.42E-02; Z-score: -2.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.68E-03; Fold-change: -3.01E-03; Z-score: -2.83E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.70E-02; Fold-change: 5.52E-02; Z-score: 5.02E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.11E-09; Fold-change: 3.73E-01; Z-score: 1.55E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.11E-02; Fold-change: 1.77E-01; Z-score: 2.56E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.86E-12; Fold-change: 4.36E-01; Z-score: 8.09E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.22E-02; Fold-change: 5.21E-01; Z-score: 1.32E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.85E-05; Fold-change: 9.00E-01; Z-score: 3.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-02; Fold-change: 1.91E-02; Z-score: 9.50E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.73E-01; Fold-change: 5.76E-03; Z-score: 1.80E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.38E-13; Fold-change: -2.40E+00; Z-score: -1.69E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.84E-93; Fold-change: -2.32E+00; Z-score: -3.11E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 6.93E-04; Fold-change: -2.41E+00; Z-score: -5.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.81E-03; Fold-change: -9.34E-02; Z-score: -3.57E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.06E-03; Fold-change: -1.60E-01; Z-score: -4.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.29E-04; Fold-change: -5.51E-01; Z-score: -5.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.25E-05; Fold-change: 1.47E-01; Z-score: 3.09E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.90E-04; Fold-change: -1.61E-01; Z-score: -3.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.71E-03; Fold-change: 5.36E-02; Z-score: 1.63E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.30E-02; Fold-change: 2.23E-02; Z-score: 1.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.79E-01; Fold-change: -3.97E-02; Z-score: -1.93E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.80E-02; Fold-change: -3.92E-02; Z-score: -4.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.02E-03; Fold-change: -1.26E-01; Z-score: -6.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.28E-01; Fold-change: 2.15E-03; Z-score: 7.85E-03
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.16E-02; Fold-change: 2.74E-01; Z-score: 1.42E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.97E-02; Fold-change: 1.25E-01; Z-score: 3.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.82E-03; Fold-change: -4.83E-01; Z-score: -1.24E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.82E-27; Fold-change: -1.31E+00; Z-score: -2.29E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.19E-01; Fold-change: -5.25E-02; Z-score: -4.77E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.20E-05; Fold-change: 5.17E-01; Z-score: 3.18E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.84E-01; Fold-change: 4.60E-02; Z-score: 4.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.25E-01; Fold-change: -7.02E-02; Z-score: -2.81E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.50E-01; Fold-change: -3.52E-02; Z-score: -1.80E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 7.30E-01; Fold-change: 1.07E-02; Z-score: 1.16E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.65E-01; Fold-change: 3.20E-02; Z-score: 1.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.71E-01; Fold-change: 7.12E-03; Z-score: 3.68E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.41E-12; Fold-change: -2.61E-01; Z-score: -3.81E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.52E-05; Fold-change: 1.99E-01; Z-score: 3.17E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.47E-02; Fold-change: 2.12E-01; Z-score: 7.38E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.39E-01; Fold-change: -1.22E-02; Z-score: -9.58E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.11E-01; Fold-change: -7.34E-02; Z-score: -3.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.27E-01; Fold-change: 3.96E-02; Z-score: 3.97E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.36E-06; Fold-change: 6.59E-02; Z-score: 2.11E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.10E-07; Fold-change: 3.21E-01; Z-score: 3.95E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.09E-02; Fold-change: -1.44E-01; Z-score: -1.93E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.23E-01; Fold-change: -2.34E-02; Z-score: -6.58E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.32E-01; Fold-change: 7.38E-02; Z-score: 4.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.55E-01; Fold-change: 3.64E-04; Z-score: 2.57E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.11E-01; Fold-change: 9.55E-02; Z-score: 1.62E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.05E-01; Fold-change: -1.49E-01; Z-score: -3.36E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.86E-02; Fold-change: 3.52E-02; Z-score: 6.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.33E-03; Fold-change: -2.03E-01; Z-score: -8.96E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.75E-01; Fold-change: -8.69E-02; Z-score: -8.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.93E-01; Fold-change: -2.22E-02; Z-score: -1.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.88E-03; Fold-change: -2.88E-01; Z-score: -1.41E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.08E-01; Fold-change: -7.97E-02; Z-score: -4.43E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.90E-01; Fold-change: 3.10E-03; Z-score: 1.75E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.35E-01; Fold-change: 1.10E-02; Z-score: 1.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.99E-01; Fold-change: 1.92E-02; Z-score: 1.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.00E-01; Fold-change: 1.26E-01; Z-score: 3.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.79E-01; Fold-change: -1.30E-02; Z-score: -9.78E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.32E-01; Fold-change: 4.39E-02; Z-score: 4.30E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.40E-01; Fold-change: -8.11E-02; Z-score: -5.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.88E-01; Fold-change: -1.69E-05; Z-score: -1.28E-04
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.54E-01; Fold-change: -2.05E-02; Z-score: -1.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.97E-02; Fold-change: -1.72E-01; Z-score: -9.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.72E-01; Fold-change: -1.75E-01; Z-score: -1.09E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 4.95E-01; Fold-change: 2.97E-01; Z-score: 6.74E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.40E-02; Fold-change: -7.76E-02; Z-score: -4.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.93E-01; Fold-change: -1.08E-02; Z-score: -7.09E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.07E-01; Fold-change: -5.57E-02; Z-score: -1.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.88E-01; Fold-change: 3.80E-02; Z-score: 1.69E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.28E-01; Fold-change: -5.54E-02; Z-score: -4.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.35E-02; Fold-change: 7.82E-02; Z-score: 4.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.06E-01; Fold-change: -4.55E-02; Z-score: -2.54E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.03E-01; Fold-change: 3.69E-02; Z-score: 1.86E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-01; Fold-change: -9.75E-02; Z-score: -4.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.14E-01; Fold-change: 5.05E-02; Z-score: 6.99E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.85E-01; Fold-change: -1.16E-01; Z-score: -6.57E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.45E-01; Fold-change: -1.69E-02; Z-score: -2.18E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.10E-01; Fold-change: -5.59E-02; Z-score: -2.63E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.86E-01; Fold-change: 1.54E-01; Z-score: 4.86E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.73E-03; Fold-change: -6.73E-01; Z-score: -1.20E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.10E-02; Fold-change: 9.95E-02; Z-score: 3.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.07E-03; Fold-change: -2.31E-01; Z-score: -5.10E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.74E-01; Fold-change: 2.25E-01; Z-score: 1.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.91E-01; Fold-change: -3.14E-02; Z-score: -1.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.75E-01; Fold-change: 5.79E-02; Z-score: 2.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.59E-01; Fold-change: 5.69E-03; Z-score: 3.26E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.98E-01; Fold-change: 3.67E-01; Z-score: 5.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.22E-03; Fold-change: -1.69E+00; Z-score: -3.55E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.78E-01; Fold-change: -1.34E-01; Z-score: -2.67E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.55E-01; Fold-change: 7.99E-02; Z-score: 2.21E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.49E-03; Fold-change: 2.21E-02; Z-score: 2.17E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.62E-02; Fold-change: 1.07E-01; Z-score: 4.44E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.12E-22; Fold-change: -5.81E-01; Z-score: -1.40E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.19E-01; Fold-change: -2.31E-01; Z-score: -1.10E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.59E-02; Fold-change: 3.00E-01; Z-score: 3.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.29E-01; Fold-change: -2.88E-02; Z-score: -7.39E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.28E-02; Fold-change: 9.71E-02; Z-score: 9.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.64E-01; Fold-change: 1.53E-01; Z-score: 1.14E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.58E-01; Fold-change: 9.97E-03; Z-score: 6.67E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.53E-01; Fold-change: 1.26E-01; Z-score: 4.92E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.46E-01; Fold-change: -4.36E-02; Z-score: -1.36E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.71E-02; Fold-change: -5.85E-02; Z-score: -7.69E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.17E-01; Fold-change: -2.70E-02; Z-score: -2.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.34E-01; Fold-change: -2.23E-02; Z-score: -9.87E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.62E-01; Fold-change: 5.13E-02; Z-score: 3.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.67E-01; Fold-change: -4.10E-02; Z-score: -5.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.51E-01; Fold-change: 4.13E-02; Z-score: 2.86E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.94E-01; Fold-change: 1.29E-01; Z-score: 7.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Metabolism of thalidomide in human microsomes, cloned human cytochrome P-450 isozymes, and Hansen's disease patients. J Biochem Mol Toxicol. 2000;14(3):140-7.
2	Laparoscopic Roux-en-Y gastric bypass surgery influenced pharmacokinetics of several drugs given as a cocktail with the highest impact observed for CYP1A2, CYP2C8 and CYP2E1 substrates. Basic Clin Pharmacol Toxicol. 2019 Aug;125(2):123-132.
3	Effect of tamoxifen on the enzymatic activity of human cytochrome CYP2B6. J Pharmacol Exp Ther. 2002 Jun;301(3):945-52.
4	Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms. Endocrinology. 2003 Aug;144(8):3382-98.
5	Nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-butanone metabolism by cytochrome P450 2B6. Drug Metab Dispos. 2005 Dec;33(12):1760-4.
6	Hepatic metabolism of diclofenac: role of human CYP in the minor oxidative pathways. Biochem Pharmacol. 1999 Sep 1;58(5):787-96.
7	FDA LABEL:Hydrocodone
8	Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules. Biochemistry. 2012 Sep 18;51(37):7225-38.
9	Metabolic Profiles of Propofol and Fospropofol: Clinical and Forensic Interpretative Aspects
10	Insights into CYP2B6-mediated drug-drug interactions. Acta Pharm Sin B. 2016 Sep;6(5):413-425.
11	Pharmacokinetics and metabolism of 14C-brivaracetam, a novel SV2A ligand, in healthy subjects. Drug Metab Dispos. 2008 Jan;36(1):36-45.
12	Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells Chem Res Toxicol. 2003 Mar;16(3):336-49. doi: 10.1021/tx025599q.
13	Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
14	A novel distal enhancer module regulated by pregnane X receptor/constitutive androstane receptor is essential for the maximal induction of CYP2B6 gene expression. J Biol Chem. 2003 Apr 18;278(16):14146-52.
15	Multiple cytochrome P-450s involved in the metabolism of terbinafine suggest a limited potential for drug-drug interactions Drug Metab Dispos. 1999 Sep;27(9):1029-38.
16	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
17	Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
18	Identification of the human P-450 enzymes responsible for the sulfoxidation and thiono-oxidation of diethyldithiocarbamate methyl ester: role of P-450 enzymes in disulfiram bioactivation Alcohol Clin Exp Res. 1998 Sep;22(6):1212-9.
19	Ninlaro- European Medicines Agency - European Union
20	Metabolism of anabolic steroids by recombinant human cytochrome P450 enzymes. Gas chromatographic-mass spectrometric determination of metabolites. J Chromatogr B Biomed Sci Appl. 1999 Nov 26;735(1):73-83.
21	The pharmacology and clinical pharmacokinetics of apomorphine SL BJU Int. 2001 Oct;88 Suppl 3:18-21. doi: 10.1046/j.1464-4096.2001.00124.x.
22	Genetic polymorphism of cytochrome P450 2D6 determines oestrogen receptor activity of the major infertility drug clomiphene via its active metabolites
23	Bupropion and 4-OH-bupropion pharmacokinetics in relation to genetic polymorphisms in CYP2B6. Pharmacogenetics. 2003 Oct;13(10):619-26.
24	FDA label of Hydrocodone bitartrate. The 2020 official website of the U.S. Food and Drug Administration.
25	Contribution of CYP3A4, CYP2B6, and CYP2C9 isoforms to N-demethylation of ketamine in human liver microsomes. Drug Metab Dispos. 2002 Jul;30(7):853-8.
26	The clinical pharmacology profile of the new antiepileptic drug perampanel: A novel noncompetitive AMPA receptor antagonist Epilepsia. 2015 Jan;56(1):12-27. doi: 10.1111/epi.12865.
27	Metabolism of beta-arteether to dihydroqinghaosu by human liver microsomes and recombinant cytochrome P450
28	Mechanistic analysis of the inactivation of cytochrome P450 2B6 by phencyclidine: effects on substrate binding, electron transfer, and uncoupling. Drug Metab Dispos. 2009 Apr;37(4):745-52.
29	Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
30	Enzymes in addition to CYP3A4 and 3A5 mediate N-demethylation of dextromethorphan in human liver microsomes. Biopharm Drug Dispos. 1999 Oct;20(7):341-6.
31	Inhibitory monoclonal antibody to human cytochrome P450 2B6. Biochem Pharmacol. 1998 May 15;55(10):1633-40.
32	Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
33	RAT CYP3A and CYP2B1/2 were not associated with nevirapine-induced hepatotoxicity. Methods Find Exp Clin Pharmacol. 2006 Sep;28(7):423-31.
34	Application of the relative activity factor approach in scaling from heterologously expressed cytochromes p450 to human liver microsomes: studies on amitriptyline as a model substrate. J Pharmacol Exp Ther. 2001 Apr;297(1):326-37.
35	Metabolite Profiling and Reaction Phenotyping for the in Vitro Assessment of the Bioactivation of Bromfenac ? Chem Res Toxicol. 2020 Jan 21;33(1):249-257. doi: 10.1021/acs.chemrestox.9b00268.
36	Regulation of CYP2B6 in primary human hepatocytes by prototypical inducers. Drug Metab Dispos. 2004 Mar;32(3):348-58.
37	FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
38	In vitro characterization of clobazam metabolism by recombinant cytochrome P450 enzymes: importance of CYP2C19. Drug Metab Dispos. 2004 Nov;32(11):1279-86.
39	The effect of cyclophosphamide with and without dexamethasone on cytochrome P450 3A4 and 2B6 in human hepatocytes. Drug Metab Dispos. 2002 Jul;30(7):814-22.
40	Evaluation of CYP2B6 induction and prediction of clinical drug-drug interactions: considerations from the IQ consortium induction working group-an industry perspective. Drug Metab Dispos. 2016 Oct;44(10):1720-30.
41	Molecular characterization of CYP2B6 substrates. Curr Drug Metab. 2008 Jun;9(5):363-73.
42	Reappraisal of human CYP isoforms involved in imipramine N-demethylation and 2-hydroxylation: a study using microsomes obtained from putative extensive and poor metabolizers of S-mephenytoin and eleven recombinant human CYPs. J Pharmacol Exp Ther. 1997 Jun;281(3):1199-210.
43	Human cytochrome P450s involved in the metabolism of 9-cis- and 13-cis-retinoic acids
44	Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
45	Further characterization of the expression in liver and catalytic activity of CYP2B6. J Pharmacol Exp Ther. 1998 Sep;286(3):1253-9.
46	PharmGKB summary: phenytoin pathway. Pharmacogenet Genomics. 2012 Jun;22(6):466-70.
47	In vitro metabolism of exemestane by hepatic cytochrome P450s: impact of nonsynonymous polymorphisms on formation of the active metabolite 17-dihydroexemestane Pharmacol Res Perspect. 2017 Apr 27;5(3):e00314. doi: 10.1002/prp2.314.
48	In vitro identification of the human cytochrome p450 enzymes involved in the oxidative metabolism of loxapine. Biopharm Drug Dispos. 2011 Oct;32(7):398-407.
49	Malathion bioactivation in the human liver: the contribution of different cytochrome p450 isoforms. Drug Metab Dispos. 2005 Mar;33(3):295-302.
50	Ospemifene metabolism in humans in vitro and in vivo: metabolite identification, quantitation, and CYP assignment of major hydroxylations. Drug Metabol Drug Interact. 2013;28(3):153-61.
51	Involvement of human cytochrome P450 2B6 in the omega- and 4-hydroxylation of the anesthetic agent propofol. Xenobiotica. 2007 Jul;37(7):717-24.
52	Clinical pharmacology of tramadol. Clin Pharmacokinet. 2004;43(13):879-923.
53	Cytochrome P450-mediated metabolism of triclosan attenuates its cytotoxicity in hepatic cells
54	Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
55	More methemoglobin is produced by benzocaine treatment than lidocaine treatment in human in vitro systems
56	Drugs that may have potential CYP2B6 interactions.
57	The impact of individual human cytochrome P450 enzymes on oxidative metabolism of anticancer drug lenvatinib
58	N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
59	Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes. Eur J Clin Pharmacol. 2004 Oct;60(8):575-81.
60	Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
61	Role of specific cytochrome P450 enzymes in the N-oxidation of the antiarrhythmic agent mexiletine. Xenobiotica. 2003 Jan;33(1):13-25.
62	Effects of olopatadine, a new antiallergic agent, on human liver microsomal cytochrome P450 activities Drug Metab Dispos. 2002 Dec;30(12):1504-11. doi: 10.1124/dmd.30.12.1504.
63	Timolol metabolism in human liver microsomes is mediated principally by CYP2D6. Drug Metab Dispos. 2007 Jul;35(7):1135-41.
64	Development, validation and application of the liquid chromatography tandem mass spectrometry method for simultaneous quantification of azilsartan medoxomil (TAK-491), azilsartan (TAK-536), and its 2 metabolites in human plasma
65	Drug Interactions with Angiotensin Receptor Blockers: Role of Human Cytochromes P450
66	Lithium Intoxication in the Elderly: A Possible Interaction between Azilsartan, Fluvoxamine, and Lithium
67	Critical evaluation of the efficacy and tolerability of azilsartan
68	Oxidative metabolism of flunarizine and cinnarizine by microsomes from B-lymphoblastoid cell lines expressing human cytochrome P450 enzymes. Biol Pharm Bull. 1996 Nov;19(11):1511-4.
69	Clopidogrel pathway. Pharmacogenet Genomics. 2010 Jul;20(7):463-5.
70	LABEL:DDYI- flibanserin tablet, film coated
71	Differential N-demethylation of l-alpha-acetylmethadol (LAAM) and norLAAM by cytochrome P450s 2B6, 2C18, and 3A4
72	Evaluation of the effects of the weak CYP3A inhibitors atorvastatin and ethinyl estradiol/norgestimate on lomitapide pharmacokinetics in healthy subjects. J Clin Pharmacol. 2016 Jan;56(1):47-55.
73	Metabolism of loratadine and further characterization of its in vitro metabolites. Drug Metab Lett. 2009 Aug;3(3):162-70.
74	Moxidectin and the avermectins: Consanguinity but not identity
75	The evolution of antiplatelet therapy in the treatment of acute coronary syndromes: from aspirin to the present day. Drugs. 2012 Nov 12;72(16):2087-116.
76	Physiologically Based Pharmacokinetic Modeling of Transdermal Selegiline and Its Metabolites for the Evaluation of Disposition Differences between Healthy and Special Populations
77	Evaluation of metabolism dependent inhibition of CYP2B6 mediated bupropion hydroxylation in human liver microsomes by monoamine oxidase inhibitors and prediction of potential as perpetrators of drug interaction. Chem Biol Interact. 2015 Mar 25;230:9-20.
78	Influence of CYP2B6 and CYP2C19 polymorphisms on sertraline metabolism in major depression patients. Int J Clin Pharm. 2016 Apr;38(2):388-94.
79	Sigmoidal kinetic model for two co-operative substrate-binding sites in a cytochrome P450 3A4 active site: an example of the metabolism of diazepam and its derivatives. Biochem J. 1999 Jun 15;340 ( Pt 3):845-53.
80	FDA label of Fedratinib. The 2020 official website of the U.S. Food and Drug Administration.
81	FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
82	Metabolism of epinastine, a histamine H1 receptor antagonist, in human liver microsomes in comparison with that of terfenadine. Res Commun Mol Pathol Pharmacol. 1997 Dec;98(3):273-92.
83	Cross-species comparisons of the pharmacokinetics of ibudilast
84	Metabolism of Meloxicam in human liver involves cytochromes P4502C9 and 3A4. Xenobiotica. 1998 Jan;28(1):1-13.
85	Human metabolic interactions of environmental chemicals. J Biochem Mol Toxicol. 2007;21(4):182-6.
86	Cytochrome P450 2B6 activity as measured by bupropion hydroxylation: effect of induction by rifampin and ethnicity. Clin Pharmacol Ther. 2006 Jul;80(1):75-84.
87	FDA Label of Romidepsin. The 2020 official website of the U.S. Food and Drug Administration.
88	Epclusa- European Medicines Agency - European Union
89	Preclinical Pharmacokinetics and First-in-Human Pharmacokinetics, Safety, and Tolerability of Velpatasvir, a Pangenotypic Hepatitis C Virus NS5A Inhibitor, in Healthy Subjects
90	Human kidney methoxyflurane and sevoflurane metabolism. Intrarenal fluoride production as a possible mechanism of methoxyflurane nephrotoxicity. Anesthesiology. 1995 Mar;82(3):689-99.
91	FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
92	Antimalarial artemisinin drugs induce cytochrome P450 and MDR1 expression by activation of xenosensors pregnane X receptor and constitutive androstane receptor. Mol Pharmacol. 2005 Jun;67(6):1954-65.
93	Ketobemidone is a substrate for cytochrome P4502C9 and 3A4, but not for P-glycoprotein. Xenobiotica. 2005 Aug;35(8):785-96.
94	In vitro metabolism of TAK-438, vonoprazan fumarate, a novel potassium-competitive acid blocker. Xenobiotica. 2017 Dec;47(12):1027-1034.
95	Assessments of CYP?inhibition?based drug-drug interaction between vonoprazan and poziotinib in?vitro and in?vivo
96	Identification of cytochrome P450 enzymes involved in the metabolism of zotepine, an antipsychotic drug, in human liver microsomes. Xenobiotica. 1999 Mar;29(3):217-29.
97	Contribution of human hepatic cytochrome p450 isoforms to the metabolism of psychotropic drugs. Biol Pharm Bull. 2005 Sep;28(9):1711-6.
98	CYP3A4 is the major CYP isoform mediating the in vitro hydroxylation and demethylation of flunitrazepam. Drug Metab Dispos. 2001 Feb;29(2):133-40.
99	Australian Public Assessment Report for asunaprevir.
100	Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
101	DrugBank(Pharmacology-Metabolism):BMS-986165
102	Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
103	CYP2B6, CYP2D6, and CYP3A4 catalyze the primary oxidative metabolism of perhexiline enantiomers by human liver microsomes. Drug Metab Dispos. 2007 Jan;35(1):128-38.
104	Effect of azole antifungals ketoconazole and fluconazole on the pharmacokinetics of dexloxiglumide. Br J Clin Pharmacol. 2005 Nov;60(5):498-507.
105	In vitro evaluation of fenfluramine and norfenfluramine as victims of drug interactions
106	DrugBank(Pharmacology-Metabolism):TAK-491
107	DrugBank(Pharmacology-Metabolism):Ganaxolone
108	DrugBank(Pharmacology-Metabolism):MRTX849
109	DrugBank(Pharmacology-Metabolism):Ag-221
110	Determination of an optimal dosing regimen for fexinidazole, a novel oral drug for the treatment of human African trypanosomiasis: first-in-human studies
111	Fexinidazole--a new oral nitroimidazole drug candidate entering clinical development for the treatment of sleeping sickness. PLoS Negl Trop Dis. 2010 Dec 21;4(12):e923.
112	Metabolism of the trisubstituted purine cyclin-dependent kinase inhibitor seliciclib (R-roscovitine) in vitro and in vivo. Drug Metab Dispos. 2008 Mar;36(3):561-70.
113	Investigation of the major human hepatic cytochrome P450 involved in 4-hydroxylation and N-dechloroethylation of trofosfamide. Cancer Chemother Pharmacol. 1999;44(4):327-34.
114	Human liver CYP2B6-catalyzed hydroxylation of RP 73401
115	Evaluation of the drug-drug interaction potential for trazpiroben (TAK-906), a D(2)/D(3) receptor antagonist for gastroparesis, towards cytochrome P450s and transporters
116	Discovery of Encequidar, First-in-Class Intestine Specific P-glycoprotein Inhibitor
117	Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
118	Inactivation of cytochrome P450 (P450) 3A4 but not P450 3A5 by OSI-930, a thiophene-containing anticancer drug
119	An assessment of human liver-derived in vitro systems to predict the in vivo metabolism and clearance of almokalant
120	In vitro metabolism of 7 neuronal nicotinic receptor agonist AZD0328 and enzyme identification for its N-oxide metabolite
121	Main metabolic pathways of TAK-802, a novel drug candidate for voiding dysfunction, in humans: the involvement of carbonyl reduction by 11-hydroxysteroid dehydrogenase 1
122	In vitro metabolism studies of nomifensine monooxygenation pathways: metabolite identification, reaction phenotyping, and bioactivation mechanism
123	Pharmacogenetic roles of CYP2C19 and CYP2B6 in the metabolism of R- and S-mephobarbital in humans. Pharmacogenetics. 2004 Aug;14(8):549-56.
124	Tumor-selective drug activation: a GDEPT approach utilizing cytochrome P450 1A1 and AQ4N. Cancer Gene Ther. 2006 Jun;13(6):598-605.
125	Identification of the cytochromes P450 that catalyze coumarin 3,4-epoxidation and 3-hydroxylation
126	Species differences and interindividual variation in liver microsomal cytochrome P450 2A enzymes: effects on coumarin, dicumarol, and testosterone oxidation
127	Urinary metabolites of dibutyl phthalate and benzophenone-3 are potential chemical risk factors of chronic kidney function markers among healthy women
128	Orphenadrine and methimazole inhibit multiple cytochrome P450 enzymes in human liver microsomes. Drug Metab Dispos. 1997 Mar;25(3):390-3.
129	In Vitro Regio- and Stereoselective Oxidation of -Ionone by Human Liver Microsomes
130	The omega-hydroxlyation of lauric acid: oxidation of 12-hydroxlauric acid to dodecanedioic acid by a purified recombinant fusion protein containing P450 4A1 and NADPH-P450 reductase
131	Cytochrome P450 4A11 inhibition assays based on characterization of lauric acid metabolites
132	Roles of human CYP2A6 and 2B6 and rat CYP2C11 and 2B1 in the 10-hydroxylation of (-)-verbenone by liver microsomes. Drug Metab Dispos. 2003 Aug;31(8):1049-53.
133	Effects of cytokine-induced macrophages on the response of tumor cells to banoxantrone (AQ4N)
134	Bioreductively activated antitumor N-oxides: the case of AQ4N, a unique approach to hypoxia-activated cancer chemotherapy
135	CYP2S1 is negatively regulated by corticosteroids in human cell lines. Toxicol Lett. 2012 Feb 25;209(1):30-4.
136	Genetic toxicology and toxicokinetics of arecoline and related areca nut compounds: an updated review
137	Synthesis, characterization, and antimalarial activity of the glucuronides of the hydroxylated metabolites of arteether
138	Use of a physiologically-based pharmacokinetic model to simulate artemether dose adjustment for overcoming the drug-drug interaction with efavirenz In Silico Pharmacol. 2013 Mar 1;1:4. doi: 10.1186/2193-9616-1-4.
139	DrugBank(Pharmacology-Metabolism)Artemether
140	Identification of metabolic pathways involved in the biotransformation of tolperisone by human microsomal enzymes. Drug Metab Dispos. 2003 May;31(5):631-6.
141	LABEL: JUXTAPID- lomitapide mesylate capsule
142	DrugBank(Pharmacology-Metabolism):Deucravacitinib
143	Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
144	Metabolic disposition of 14C-bromfenac in healthy male volunteers J Clin Pharmacol. 1998 Aug;38(8):744-52. doi: 10.1002/j.1552-4604.1998.tb04815.x.
145	DrugBank(Pharmacology-Metabolism)Bupropion
146	Carbamazepine and its metabolites in human perfused placenta and in maternal and cord blood Epilepsia. 1995 Mar;36(3):241-8. doi: 10.1111/j.1528-1157.1995.tb00991.x.
147	Kinetics and metabolism of clobazam in animals and man
148	The KEGG resource for deciphering the genome
149	Aprepitant inhibits cyclophosphamide bioactivation and thiotepa metabolism
150	LC-MS/MS analysis of dextromethorphan metabolism in human saliva and urine to determine CYP2D6 phenotype and individual variability in N-demethylation and glucuronidation J Chromatogr B Analyt Technol Biomed Life Sci. 2004 Dec 25;813(1-2):217-25. doi: 10.1016/j.jchromb.2004.09.040.
151	Classics in Chemical Neuroscience: Dextromethorphan (DXM). ACS Chem Neurosci. 2023 Jun 21;14(12):2256-2270. doi: 10.1021/acschemneuro.3c00088.
152	Study on the Pharmacokinetics of Diazepam and Its Metabolites in Blood of Chinese People Eur J Drug Metab Pharmacokinet. 2020 Aug;45(4):477-485. doi: 10.1007/s13318-020-00614-8.
153	Pharmacokinetics of Diazepam and Its Metabolites in Urine of Chinese Participants. Drugs R D. 2022 Mar;22(1):43-50. doi: 10.1007/s40268-021-00375-y.
154	Kinetic disposition of diazepam and its metabolites after intravenous administration of diazepam in the horse: Relevance for doping control. J Vet Pharmacol Ther. 2021 Sep;44(5):733-744. doi: 10.1111/jvp.12991.
155	DrugBank(Pharmacology-Metabolism)Diazepam
156	Plasma and synovial fluid concentrations of diclofenac sodium and its major hydroxylated metabolites during long-term treatment of rheumatoid arthritis Eur J Clin Pharmacol. 1983;25(3):389-94. doi: 10.1007/BF01037953.
157	Simultaneous determination of diclofenac sodium and its hydroxy metabolites by capillary column gas chromatography with electron-capture detection J Chromatogr. 1981 Nov 6;217:263-71. doi: 10.1016/s0021-9673(00)88081-4.
158	Identification of the human P-450 enzymes responsible for the sulfoxidation and thiono-oxidation of diethyldithiocarbamate methyl ester: role of P-450 enzymes in disulfiram bioactivation. Alcohol Clin Exp Res. 1998 Sep;22(6):1212-9.
159	Induction of CYP3A4 by efavirenz in primary human hepatocytes: comparison with rifampin and phenobarbital. J Clin Pharmacol. 2004 Nov;44(11):1273-81.
160	Biotransformation of Efavirenz and Proteomic Analysis of Cytochrome P450s and UDP-Glucuronosyltransferases in Mouse, Macaque, and Human Brain-Derived In Vitro Systems. Drug Metab Dispos. 2023 Apr;51(4):521-531. doi: 10.1124/dmd.122.001195.
161	Liver Cirrhosis Affects the Pharmacokinetics of the Six Substrates of the Basel?Phenotyping Cocktail Differently. Clin Pharmacokinet. 2022 Jul;61(7):1039-1055. doi: 10.1007/s40262-022-01119-0.
162	Instability of Efavirenz Metabolites Identified During Method Development and Validation. J Pharm Sci. 2021 Oct;110(10):3362-3366. doi: 10.1016/j.xphs.2021.06.028.
163	FDA:Enasidenib
164	Simultaneous measurement of epinastine and its metabolite, 9,13b-dehydroepinastine, in human plasma by a newly developed ultra-performance liquid chromatography-tandem mass spectrometry and its application to pharmacokinetic studies Biomed Chromatogr. 2020 Sep;34(9):e4848. doi: 10.1002/bmc.4848.
165	In vitro metabolism of exemestane by hepatic cytochrome P450s: impact of nonsynonymous polymorphisms on formation of the active metabolite 17beta-dihydroexemestane. Pharmacol Res Perspect. 2017 Apr 27;5(3):e00314.
166	U. S. FDA Label -Fenfluramine
167	Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
168	(R)-, (S)-, and racemic fluoxetine N-demethylation by human cytochrome P450 enzymes. Drug Metab Dispos. 2000 Oct;28(10):1187-91.
169	Simultaneous identification and quantitation of fluoxetine and its metabolite, norfluoxetine, in biological samples by GC-MS
170	Ganaxolone
171	Cytochromes P450: a structure-based summary of biotransformations using representative substrates Drug Metab Rev. 2008;40(1):1-100. doi: 10.1080/03602530802309742.
172	DrugBank(Pharmacology-Metabolism):Hydrocodone bitartrate
173	CYP2D6 and CYP3A4 involvement in the primary oxidative metabolism of hydrocodone by human liver microsomes. Br J Clin Pharmacol. 2004 Mar;57(3):287-97.
174	2-Chloroacetaldehyde-induced cerebral glutathione depletion and neurotoxicity
175	PubChem : JNJ-54135419
176	The clinical toxicology of ketamine. Clin Toxicol (Phila). 2023 Jun;61(6):415-428. doi: 10.1080/15563650.2023.2212125.
177	Pharmacokinetics of Ketamine Transfer Into Human Milk. J Clin Psychopharmacol. 2023 May 23. doi: 10.1097/JCP.0000000000001711.
178	Chronic exposure to (2?R,6?R)-hydroxynorketamine induces developmental neurotoxicity in hESC-derived cerebral organoids. J Hazard Mater. 2023 Jul 5;453:131379. doi: 10.1016/j.jhazmat.2023.131379.
179	Identification of the cytochrome P450 enzymes involved in the metabolism of domperidone. Xenobiotica. 2004 Nov-Dec;34(11-12):1013-23.
180	A prospective longitudinal study of growth in twin gestations compared with growth in singleton pregnancies. I. The fetal head J Ultrasound Med. 1991 Aug;10(8):439-43. doi: 10.7863/jum.1991.10.8.439.
181	Meperidine and normeperidine levels following meperidine administration during labor. I. Mother
182	Effects of ethinyl estradiol on pharmacokinetics of meperidine and pentobarbital in the rat
183	Impact of cytochrome P450 variation on meperidine N-demethylation to the neurotoxic metabolite normeperidine. Xenobiotica. 2020 Feb;50(2):209-222.
184	Quantification of mephenytoin and its metabolites 4'-hydroxymephenytoin and nirvanol in human urine using a simple sample processing method
185	Relation of in vivo drug metabolism to stereoselective fetal hydantoin toxicology in mouse: evaluation of mephenytoin and its metabolite, nirvanol
186	Metamizole (Dipyrone) and the Liver: A Review of the Literature J Clin Pharmacol. 2019 Nov;59(11):1433-1442. doi: 10.1002/jcph.1512.
187	Clinical pharmacokinetics of dipyrone and its metabolites Clin Pharmacokinet. 1995 Mar;28(3):216-34. doi: 10.2165/00003088-199528030-00004.
188	Effects of cytochrome P450 single nucleotide polymorphisms on methadone metabolism and pharmacodynamics
189	Synthetic and natural compounds that interact with human cytochrome P450 1A2 and implications in drug development. Curr Med Chem. 2009;16(31):4066-218.
190	DrugBank(Pharmacology-Metabolism):Adagrasib
191	Identification of human cytochrome P450 isozymes involved in the metabolism of naftopidil enantiomers in vitro. J Pharm Pharmacol. 2014 Nov;66(11):1534-51.
192	Characterization of Ca(2+)-antagonistic effects of three metabolites of the new antihypertensive agent naftopidil, (naphthyl)hydroxy-naftopidil, (phenyl)hydroxy-naftopidil, and O-desmethyl-naftopidil J Cardiovasc Pharmacol. 1991 Dec;18(6):918-25. doi: 10.1097/00005344-199112000-00020.
193	U. S. FDA Label -Nevirapine
194	U. S. FDA Label -Nicotine
195	Pharmacokinetics, Metabolite Measurement, and Biomarker Identification of Dermal Exposure to Permethrin Using Accelerator Mass Spectrometry. Toxicol Sci. 2021 Aug 30;183(1):49-59. doi: 10.1093/toxsci/kfab082.
196	Validation of enantioseparation and quantitation of an active metabolite of abrocitinib in human plasma
197	DrugBank(Pharmacology-Metabolism)Phenobarbital
198	Quantitation of N-(3,5-dichloropyrid-4-yl)-3-cyclopentyloxy-4-methoxybenzamide and 4-amino-3,5-dichloropyridine in rat and mouse plasma by LC/MS/MS
199	Determination of the active and inactive metabolites of prasugrel in human plasma by liquid chromatography/tandem mass spectrometry Rapid Commun Mass Spectrom. 2007;21(2):169-79. doi: 10.1002/rcm.2813.
200	Interactions of fentanyl with blood platelets and plasma proteins: platelet sensitivity to prasugrel metabolite is not affected by fentanyl under in vitro conditions. Pharmacol Rep. 2023 Apr;75(2):423-441. doi: 10.1007/s43440-023-00447-7.
201	Pharmacokinetic and Pharmacodynamic Modeling and Simulation Analysis of Prasugrel in Healthy Male Volunteers. Clin Pharmacol Drug Dev. 2023 Jan;12(1):21-29. doi: 10.1002/cpdd.1172.
202	Identification of cytochrome P450 enzymes involved in the metabolism of FK228, a potent histone deacetylase inhibitor, in human liver microsomes. Biol Pharm Bull. 2005 Jan;28(1):124-9.
203	Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102.
204	Detection of l-Methamphetamine and l-Amphetamine as Selegiline Metabolites. J Anal Toxicol. 2021 Feb 6;45(1):99-104. doi: 10.1093/jat/bkaa058.
205	Sertraline is metabolized by multiple cytochrome P450 enzymes, monoamine oxidases, and glucuronyl transferases in human: an in vitro study. Drug Metab Dispos. 2005 Feb;33(2):262-70.
206	Pharmacogenetic Testing and Therapeutic Drug Monitoring Of Sertraline at a Residential Treatment Center for Children and Adolescents: A Pilot Study. Innov Pharm. 2022 Dec 26;13(4):10.24926/iip.v13i4.5035. doi: 10.24926/iip.v13i4.5035.
207	Sertraline. 2022 May 15. Drugs and Lactation Database (LactMed?) [Internet]. Bethesda (MD): National Institute of Child Health and Human Development; 2006C.
208	Neonicotinoids and pharmaceuticals in hair of the Red fox (Vulpes vulpes) from the Cavallino-Treporti peninsula, Italy. Environ Res. 2023 Jul 1;228:115837. doi: 10.1016/j.envres.2023.115837.
209	Metabolism of tamoxifen by recombinant human cytochrome P450 enzymes: formation of the 4-hydroxy, 4'-hydroxy and N-desmethyl metabolites and isomerization of trans-4-hydroxytamoxifen. Drug Metab Dispos. 2002 Aug;30(8):869-74.
210	Endoxifen and other metabolites of tamoxifen inhibit human hydroxysteroid sulfotransferase 2A1 (hSULT2A1). Drug Metab Dispos. 2014 Nov;42(11):1843-50.
211	Metabolism and transport of tamoxifen in relation to its effectiveness: new perspectives on an ongoing controversy. Future Oncol. 2014 Jan;10(1):107-22.
212	The tamoxifen dilemma. Carcinogenesis. 1999 Jul;20(7):1153-60.
213	Pharmacokinetics and metabolism of temazepam in man and several animal species Br J Clin Pharmacol. 1979;8(1):23S-29S. doi: 10.1111/j.1365-2125.1979.tb00451.x.
214	Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66.
215	Multiple cytochrome P-450s involved in the metabolism of terbinafine suggest a limited potential for drug-drug interactions. Drug Metab Dispos. 1999 Sep;27(9):1029-38.
216	A multi-residue chiral liquid chromatography coupled with tandem mass spectrometry method for analysis of antifungal agents and their metabolites in aqueous environmental matrices. Anal Methods. 2021 Jun 14;13(22):2466-2477. doi: 10.1039/d1ay00556a.
217	DrugBank(Pharmacology-Metabolism):Ticlopidine
218	Trends in Tramadol: Pharmacology, Metabolism, and Misuse Anesth Analg. 2017 Jan;124(1):44-51. doi: 10.1213/ANE.0000000000001683.
219	Simultaneous LC-MS/MS quantification of oxycodone, tramadol and fentanyl and their metabolites (noroxycodone, oxymorphone, O- desmethyltramadol, N- desmethyltramadol, and norfentanyl) in human plasma and whole blood collected via venepuncture and volumetric absorptive micro sampling. J Pharm Biomed Anal. 2021 Sep 5;203:114171. doi: 10.1016/j.jpba.2021.114171.
220	Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
221	Retinoic acid metabolism and mechanism of action: a review
222	LABEL:KLIEF- trifarotene cream
223	A simple and sensitive HPLC-FL method for bioanalysis of velpatasvir, a novel hepatitis C virus NS5A inhibitor, in rat plasma: Investigation of factors determining its oral bioavailability J Chromatogr B Analyt Technol Biomed Life Sci. 2022 Oct 1;1208:123399. doi: 10.1016/j.jchromb.2022.123399.
224	Vonoprazan fumarate, a novel potassium-competitive acid blocker, in the management of gastroesophageal reflux disease: safety and clinical evidence to date
225	Vortioxetine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2018 Jun;57(6):673-686.
226	FDA Approved Drug Products:Oxbryta (voxelotor) tablets
227	BioTransformer: a comprehensive computational tool for small molecule metabolism prediction and metabolite identification
228	Metabolism and transport of oxazaphosphorines and the clinical implications Drug Metab Rev. 2005;37(4):611-703. doi: 10.1080/03602530500364023.
229	Norzotepine, a major metabolite of zotepine, exerts atypical antipsychotic-like and antidepressant-like actions through its potent inhibition of norepinephrine reuptake

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.