Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0004)
DME Name	UDP-glucuronosyltransferase 1A1 (UGT1A1), Homo sapiens
Synonyms	UDP-glucuronosyltransferase family 1 member A1; UDP-glucuronosyltransferase 1-A; UDP-glucuronosyltransferase 1-1; Bilirubin-specific UDPGT isozyme 1; UDPGT 1-1; UGT-1A; GNT1; UGT1; UGT1*1; UGT1-01; UGT1.1; UGT1A; UGT1A1; hUG-BR1
Gene Name	UGT1A1
UniProt ID	UD11_HUMAN
Gene ID	54658
EC Number	EC: 2.4.1.17 (Click to Show/Hide the Complete EC Tree) Transferase Glycosyltransferases Hexosyltransferase EC: 2.4.1.17
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVL APDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDS AMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLE FEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQR EVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH GIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDL LGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD LTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Pathway	Ascorbate and aldarate metabolism (hsa00053 )
	Chemical carcinogenesis (hsa05204 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Drug metabolism - other enzymes (hsa00983 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Pentose and glucuronate interconversions (hsa00040 )
	Porphyrin and chlorophyll metabolism (hsa00860 )
	Retinol metabolism (hsa00830 )
	Steroid hormone biosynthesis (hsa00140 )
Function	This enzyme catalyzes the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 124 Drugs
Darolutamide	Drug Info	Approved	Prostate cancer	ICD11: 2C82	[1]
Tamoxifen citrate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[2]
Nintedanib esylate	Drug Info	Approved	Idiopathic pulmonary fibrosis	ICD11: CB03	[3]
Warfarin sodium	Drug Info	Approved	Atrial fibrillation	ICD11: BC81	[4]
Estradiol acetate	Drug Info	Approved	Acquired prion disease	ICD11: 8E01	[5]
Estradiol cypionate	Drug Info	Approved	Acquired prion disease	ICD11: 8E01	[5]
Estradiol valerate	Drug Info	Approved	Acquired prion disease	ICD11: 8E01	[5]
Methylphenidate	Drug Info	Approved	Attention deficit hyperactivity disorder	ICD11: 6A05	[6]
Nicotine	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[7]
Atazanavir	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[8]
Dronabinol	Drug Info	Approved	Anorexia nervosa	ICD11: 6B80	[9]
Ibrutinib	Drug Info	Approved	Mantle cell lymphoma	ICD11: 2A85	[10]
Naloxone	Drug Info	Approved	Opiate dependence	ICD11: 6C43	[11]
Metronidazole	Drug Info	Approved	Amebiasis	ICD11: 1A36	[12]
Cannabidiol	Drug Info	Approved	Lennox-Gastaut syndrome	ICD11: 8A62	[13]
Clomipramine hydrochloride	Drug Info	Approved	Obsessive-compulsive disorder	ICD11: 6B20	[14]
Ethinyl estradiol	Drug Info	Approved	Menopausal disorder	ICD11: GA30	[12]
Mycophenolate mofetil	Drug Info	Approved	Crohn disease	ICD11: DD70	[15]
Valproic acid	Drug Info	Approved	Epilepsy	ICD11: 8A60	[16]
Cyproheptadine	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[17]
Febuxostat	Drug Info	Approved	Hyperuricaemia	ICD11: 5C55	[18]
Labetalol	Drug Info	Approved	Essential hypertension	ICD11: BA00	[19]
Opicapone	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[20]
Chenodeoxycholic acid	Drug Info	Approved	Cholelithiasis	ICD11: DC11	[21]
Hydrocodone bitartrate	Drug Info	Approved	Neuropathic pain	ICD11: 8E43	[22]
Indinavir sulfate	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[23]
Suprofen	Drug Info	Approved	Iris sphincter disorder	ICD11: 9B01	[9]
Axitinib	Drug Info	Approved	Renal cell carcinoma	ICD11: 2C90	[24]
Carvedilol	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[12]
Digitoxin	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[25]
Estriol	Drug Info	Approved	Menopausal disorder	ICD11: GA30	[26]
Formoterol	Drug Info	Approved	Asthma	ICD11: CA23	[27]
Ketoprofen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[28]
Lasofoxifene	Drug Info	Approved	Osteoporosis	ICD11: FB83	[29]
Minoxidil	Drug Info	Approved	Essential hypertension	ICD11: BA00	[30]
Naproxen	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[31]
Repaglinide	Drug Info	Approved	Diabetes mellitus	ICD11: 5A10	[32]
Amitriptyline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[7]
Belinostat	Drug Info	Approved	Anaplastic large cell lymphoma	ICD11: 2A90	[33]
Codeine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[34]
Deferasirox	Drug Info	Approved	Hyperphosphatemia	ICD11: 5C64	[35]
Desvenlafaxine	Drug Info	Approved	Major depressive disorder	ICD11: 6A70-6A7Z	[36]
Dolutegravir sodium	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[37]
Dolutegravir sodium	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[38]
Dronedarone hydrochloride	Drug Info	Approved	Atrial fibrillation	ICD11: BC81	[39]
Eslicarbazepine acetate	Drug Info	Approved	Epilepsy	ICD11: 8A60	[40]
Eslicarbazepine acetate	Drug Info	Approved	Epilepsy	ICD11: 8A60	[41]
Etodolac	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[42]
Exjade	Drug Info	Approved	Hyperphosphatemia	ICD11: 5C64	[43]
Ibuprofen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[44], [9]
Imipramine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[7]
Indomethacin	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[45]
Letermovir	Drug Info	Approved	Cytomegalovirus infection	ICD11: 1D82	[46]
Mercaptopurine	Drug Info	Approved	Acute lymphoblastic leukemia	ICD11: 2B33	[47]
Morphine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[48]
Morphine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[44], [49], [50]
Oxymetazoline	Drug Info	Approved	Erythema multiforme	ICD11: EB12	[51]
Phenytoin	Drug Info	Approved	Epilepsy	ICD11: 8A60	[44]
Probenecid	Drug Info	Approved	Hyperuricaemia	ICD11: 5C55	[52]
Rilpivirine hydrochloride	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[53]
Riluzole	Drug Info	Approved	Amyotrophic lateral sclerosis	ICD11: 8B60	[54]
Rucaparib	Drug Info	Approved	Ovarian cancer	ICD11: 2C73	[55]
Simvastatin	Drug Info	Approved	Dyslipidaemia	ICD11: 5C81	[56]
Abacavir	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[57]
Anastrozole	Drug Info	Approved	Breast cancer	ICD11: 2C60	[58]
Aspirin	Drug Info	Approved	Myocardial infarction	ICD11: BA41	[59]
Atorvastatin calcium	Drug Info	Approved	Dyslipidaemia	ICD11: 5C81	[60]
Buprenorphine hydrochloride	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[61]
Clofazimine	Drug Info	Approved	Crohn disease	ICD11: DD70	[62]
Epinephrine hydrochloride	Drug Info	Approved	Allergy	ICD11: 4A80	[63]
Gemfibrozil	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[64]
Glipizide	Drug Info	Approved	Diabetes mellitus	ICD11: 5A10	[12]
Intedanib	Drug Info	Approved	Idiopathic pulmonary fibrosis	ICD11: CB03	[65]
Levothyroxine sodium	Drug Info	Approved	Hypothyroidism	ICD11: 5A00	[12]
Liothyronine	Drug Info	Approved	Hypothyroidism	ICD11: 5A00	[66]
Propofol	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[67]
Raloxifene	Drug Info	Approved	Osteoporosis	ICD11: FB83	[12]
Tecovirimat	Drug Info	Approved	Smallpox	ICD11: 1E70	[68]
Acetaminophen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[69]
Binimetinib	Drug Info	Approved	Melanoma	ICD11: 2C30	[70]
Candesartan cilexetil	Drug Info	Approved	Essential hypertension	ICD11: BA00	[71]
Desloratadine	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[72]
Etoposide	Drug Info	Approved	Lung cancer	ICD11: 2C25	[73]
Ezetimibe	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[74]
Lamotrigine	Drug Info	Approved	Bipolar disorder	ICD11: 6A60	[12]
Losartan potassium	Drug Info	Approved	Essential hypertension	ICD11: BA00	[71]
Lovastatin	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[56]
Mycophenolic acid	Drug Info	Approved	Crohn disease	ICD11: DD70	[44], [75]
Mycophenolic acid	Drug Info	Approved	Crohn disease	ICD11: DD70	[76]
Pitavastatin calcium	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[77]
Riociguat	Drug Info	Approved	Pulmonary hypertension	ICD11: BB01	[78]
Selinexor	Drug Info	Approved	Multiple myeloma	ICD11: 2A83	[79]
Troglitazone	Drug Info	Approved	Diabetes mellitus	ICD11: 5A10	[80]
Zidovudine	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[81]
Cerivastatin sodium	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[82]
Diflunisal	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[83]
Edaravone	Drug Info	Approved	Cerebral stroke	ICD11: 8B11	[84]
Eltrombopag olamine	Drug Info	Approved	Thrombocytopenia	ICD11: 3B64	[85]
Elvitegravir	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[86]
Flurbiprofen sodium	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[87]
Furosemide	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[12]
Hesperidin	Drug Info	Approved	Vascular purpura	ICD11: 3B60	[88]
Hydromorphone	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[89]
Loratadine	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[90]
Oxazepam	Drug Info	Approved	Anxiety disorder	ICD11: 6B00	[91]
Selexipag	Drug Info	Approved	Pulmonary hypertension	ICD11: BB01	[92]
Tiagabine	Drug Info	Approved	Epilepsy	ICD11: 8A60	[93]
Vericiguat	Drug Info	Approved	Heart failure	ICD11: BD10-BD1Z	[94]
Vorinostat	Drug Info	Approved	Cutaneous T-cell lymphoma	ICD11: 2B01	[95]
Voxelotor	Drug Info	Approved	Sickle-cell anaemia	ICD11: 3A51	[96]
Zonisamide	Drug Info	Approved	Epilepsy	ICD11: 8A60	[93]
Delafloxacin	Drug Info	Approved	Methicillin-resistant staphylococcus infection	ICD11: 1D01	[97]
Enasidenib	Drug Info	Approved	Acute myeloid leukaemia	ICD11: 2A60	[98]
Fulvestrant	Drug Info	Approved	Breast cancer	ICD11: 2C60	[99]
Hydroxyprogesterone caproate	Drug Info	Approved	Uterine cancer	ICD11: 2C76	[100]
Indacaterol maleate	Drug Info	Approved	Chronic obstructive pulmonary disease	ICD11: CA22	[101]
Lenacapavir	Drug Info	Approved	Discovery agent	ICD: N.A.	[102]
Naltrexone	Drug Info	Approved	Alcohol dependence	ICD11: 6C40	[103]
Posaconazole	Drug Info	Approved	Candidiasis	ICD11: 1F23	[104]
Raltegravir potassium	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[105]
Sacituzumab govitecan	Drug Info	Approved	Discovery agent	ICD: N.A.	[106]
Telmisartan	Drug Info	Approved	Essential hypertension	ICD11: BA00	[107]
Meprobamate	Drug Info	Approved	Anxiety disorder	ICD11: 6B00	[108]
LAROPIPRANT	Drug Info	Phase 4	Atherosclerosis	ICD11: BA80	[111]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 11 Drugs
Ethinylestradiol propanesulfonate	Drug Info	Phase 4	Prostate cancer	ICD11: 2C82	[109], [110]
Glibenclamide	Drug Info	Phase 4	Diabetes mellitus	ICD11: 5A10	[45]
Pirprofen	Drug Info	Phase 4	Rheumatoid arthritis	ICD11: FA20	[112]
Tranilast	Drug Info	Phase 4	Conjunctivitis	ICD11: 9A60	[113], [114]
Androstanolone	Drug Info	Phase 4	Hypogonadism	ICD11: 5A61	[115]
Phenolphthalein	Drug Info	Phase 4	Irritable bowel syndrome	ICD11: DD91	[116]
Retigabine	Drug Info	Phase 4	Epilepsy	ICD11: 8A60	[117]
Silymarin	Drug Info	Phase 4	Fatty liver disease	ICD11: DB92	[118]
Bazedoxifene	Drug Info	Phase 4	Schizophrenia	ICD11: 6A20	[119]
Dexibuprofen	Drug Info	Phase 4	Osteoarthritis	ICD11: FA00	[9]
Oleandomycin	Drug Info	Phase 4	Acute upper respiratory infection	ICD11: CA07	[120]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 18 Drugs
E-3A	Drug Info	Phase 3	Turner syndrome	ICD11: LD50	[5]
Selumetinib	Drug Info	Phase 3	Neurofibromatosis	ICD11: LD2D	[121]
AKB-6548	Drug Info	Phase 3	Anaemia	ICD11: 3A90	[122]
BMS-298585	Drug Info	Phase 3	Diabetes mellitus	ICD11: 5A10	[123]
Curcumin	Drug Info	Phase 3	Stomach cancer	ICD11: 2B72	[124]
LAU-7b	Drug Info	Phase 3	Macular degeneration	ICD11: 9B78	[125]
Bexagliflozin	Drug Info	Phase 3	Type-2 diabetes	ICD11: 5A11	[126]
CEM-102	Drug Info	Phase 3	Endocarditis	ICD11: 1B12	[127]
Heroin	Drug Info	Phase 3	Opiate dependence	ICD11: 6C43	[128]
AD-5423	Drug Info	Phase 3	Schizophrenia	ICD11: 6A20	[129]
Losartan	Drug Info	Phase 3	Hypertension	ICD11: BA00-BA04	[71]
YKP-509	Drug Info	Phase 3	Dyskinesia	ICD11: 8A02	[130]
LNP023	Drug Info	Phase 3	IgA nephropathy	ICD11: MF8Y	[131]
Etirinotecan pegol	Drug Info	Phase 3	Breast cancer	ICD11: 2C60-2C6Y	[132]
LCQ908-NXA	Drug Info	Phase 3	Hypertriglyceridaemia	ICD11: 5C80	[133]
KAD-1229	Drug Info	Phase 3	Diabetes mellitus	ICD11: 5A10	[134]
Ag-221	Drug Info	Phase 3	Acute myelogenous leukaemia	ICD11: 2A41	[135]
Atorvastatin	Drug Info	Phase 3	Hypertriglyceridaemia	ICD11: 5C80	[136]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 20 Drugs
ENT-1814	Drug Info	Phase 2/3	Bell palsy	ICD11: 8B88	[137]
Puerarin	Drug Info	Phase 2	Alcohol dependence	ICD11: 6C40	[138]
BAICALEIN	Drug Info	Phase 2	Influenza virus infection	ICD11: 1E30-1E32	[139]
Ethanol	Drug Info	Phase 2	Diabetic nephropathy	ICD11: GB61	[140]
LJN452	Drug Info	Phase 2	Primary biliary cholangitis	ICD11: DB96	[141]
PT2385	Drug Info	Phase 2	Von hippel-lindau disease	ICD11: 5A75	[142]
BCP-13498	Drug Info	Phase 2	Anaesthesia	ICD11: 8E22	[143]
GSK-1265744	Drug Info	Phase 2	Human immunodeficiency virus infection	ICD11: 1C60	[144]
AMG 232	Drug Info	Phase 2	Merkel cell carcinoma	ICD11: 2C34	[145]
BIA 3-202	Drug Info	Phase 2	Parkinsonism	ICD11: 8A00	[146]
AUS-131	Drug Info	Phase 2	Prostatic hyperplasia	ICD11: GA90	[147]
ABT-751	Drug Info	Phase 2	Breast cancer	ICD11: 2C60	[148]
AR-67	Drug Info	Phase 2	Brain cancer	ICD11: 2A00	[149]
BN-1270	Drug Info	Phase 2	Pulmonary hypertension	ICD11: BB01	[150]
VS-6063	Drug Info	Phase 2	Mesothelioma	ICD11: 2C51	[151]
BAY-85-3934	Drug Info	Phase 2	Anemia	ICD11: 3A00-3A9Z	[152]
Sitafloxacin	Drug Info	Phase 2	Escherichia coli infection	ICD11: 1A03	[153]
SN-38	Drug Info	Phase 2	Colorectal cancer	ICD11: 2B91	[154]
HMR-1275	Drug Info	Phase 2	Chronic lymphocytic leukaemia	ICD11: 2A82	[12]
ICI-79,280	Drug Info	Phase 2	Ductal carcinoma	ICD11: 2E65	[155]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 10 Drugs
CB-3304	Drug Info	Phase 1/2	Chronic lymphocytic leukaemia	ICD11: 2A82	[156]
LM-94	Drug Info	Phase 1/2	Cholangitis	ICD11: DC13	[157]
TMC-120	Drug Info	Phase 1/2	Human immunodeficiency virus infection	ICD11: 1C60	[158]
AG-1549	Drug Info	Phase 1	Human immunodeficiency virus infection	ICD11: 1C60	[159]
BRN-0183227	Drug Info	Phase 1	Acute coronary syndrome	ICD11: BA4Z	[160]
GS-9883	Drug Info	Phase 1	Human immunodeficiency virus infection	ICD11: 1C60	[161]
TAS-103	Drug Info	Phase 1	Colon cancer	ICD11: 2B90	[162]
Norbuprenorphine	Drug Info	Phase 1	Human immunodeficiency virus infection	ICD11: 1C60-1C62	[163]
OTSSP167	Drug Info	Phase 1	Myelodysplastic syndrome	ICD11: 2A37	[164]
UP-83	Drug Info	Phase 1	Rheumatoid arthritis	ICD11: FA20	[165]
Discontinued/withdrawn Drugs			Click to Show/Hide the Full List of Drugs: 4 Drugs
Motesanib	Drug Info	Discontinued in Phase 3	Lung cancer	ICD11: 2C25	[166]
Lexacalcitol	Drug Info	Discontinued in Phase 2	Solid tumour/cancer	ICD11: 2A00-2F9Z	[167], [168]
T-5224	Drug Info	Discontinued in Phase 2	Rheumatoid arthritis	ICD11: FA20	[169]
GV-150526	Drug Info	Discontinued	Cerebral stroke	ICD11: 8B11	[9]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 9 Drugs
Phenanthrenequinone	Drug Info	Investigative	Discovery agent	ICD: N.A.	[170]
Eugenol	Drug Info	Investigative	Discovery agent	ICD: N.A.	[124]
Chloroxylenol	Drug Info	Investigative	Pseudomonas infection	ICD11: 1G40	[171]
Hydroxyestrone	Drug Info	Investigative	Discovery agent	ICD: N.A.	[172]
Phloretin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[124]
Chrysin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[124]
Cis-4-hydroxytamoxifen	Drug Info	Investigative	Discovery agent	ICD: N.A.	[155]
Alpha-D-galactose	Drug Info	Investigative	Discovery agent	ICD: N.A.	[173]
Anthraflavic acid	Drug Info	Investigative	Discovery agent	ICD: N.A.	[124]
Experimental Enzyme Kinetic Data of Drugs			Click to Show/Hide the Full List of Drugs: 9 Drugs
Curcumin	Drug Info	Phase 3	Stomach cancer	Km = 0.1 microM	[124]
Ethanol	Drug Info	Phase 2	Diabetic nephropathy	Km = 8.03 microM	[140]
ICI-79,280	Drug Info	Phase 2	Ductal carcinoma	Km = 0.004 microM	[155]
Eugenol	Drug Info	Investigative	Discovery agent	Km = 0.0084 microM	[124]
Phloretin	Drug Info	Investigative	Discovery agent	Km = 0.0068 microM	[124]
Chrysin	Drug Info	Investigative	Discovery agent	Km = 0.004 microM	[124]
Cis-4-hydroxytamoxifen	Drug Info	Investigative	Discovery agent	Km = 0.0074 microM	[155]
ACMC-1AKLT	Drug Info	Investigative	Discovery agent	Km = 0.198 microM	[5]
Anthraflavic acid	Drug Info	Investigative	Discovery agent	Km = 0.01 microM	[124]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR009211	3,4-Dihydroxycinnamic Acid	Caffeic acid-4'-O-glucuronide	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[174]
MR009204	Ferulic acid	Ferulic acid-4'-O-glucuronide	Unclear - Unclear	3,4-Dihydroxycinnamic Acid	[174]
MR007242	ABT-751	ABT-751 glucuronide	Unclear - Unclear	ABT-751	[148]
MR000048	Acetaminophen	Acetaminophen glucuronide	Conjugation - Glucuronidation	Acetaminophen	[175], [176], [177]
MR009665	Blonanserin M5	Blonanserin M6	Conjugation - Glucuronidation	AD-5423	[129]
MR009667	Blonanserin M7	Blonanserin M8	Conjugation - Glucuronidation	AD-5423	[129]
MR009142	AKB-6548	Vadadustat-O-glucuronide	Conjugation - O-glucuronidation	AKB-6548	[122]
MR009143	AKB-6548	Vadadustat acyl glucuronide	Conjugation - O-glucuronidation	AKB-6548	[122]
MR000159	Alpha-D-galactose	Alpha-D-galactose 1-phosphate	Other reaction - Phosphorylation; Galactokinase	Alpha-D-galactose	[173], [178], [179]
MR007485	Anthraflavic acid	Unclear	Unclear - Unclear	Anthraflavic acid	[124]
MR011560	AR-67	AR-67 glucuronides	Unclear - Unclear	AR-67	[149]
MR004600	AUS-131	S-equol 4'-glucuronide	Unclear - Unclear	AUS-131	[147]
MR004604	AUS-131	S-equol 7-glucuronide	Unclear - Unclear	AUS-131	[147]
MR009888	Axitinib	Axitinib Metabolite M7	Unclear - Unclear	axitinib	[180]
MR008613	BAICALEIN	Baicalein-7-O-glucuronide	Unclear - Unclear	BAICALEIN	[181]
MR011319	BAY-85-3934	BAY-85-3934 Metabolite M1	Unclear - Unclear	BAY-85-3934	[182], [152]
MR000349	Bazedoxifene	Bazedoxifene-5-glucuronide	Conjugation - Glucuronidation	Bazedoxifene	[119]
MR000350	Bazedoxifene	Bazedoxifene-4'-glucuronide	Conjugation - Glucuronidation	Bazedoxifene	[119]
MR007297	Paracetamol	Glucuronidation of paracetamol	Conjugation - Glucuronidation	BCP-13498	[143]
MR011597	Bexagliflozin	EGT0002149	Conjugation - O-glucuronidation	Bexagliflozin	[126]
MR007558	Bilirubin	Bilirubin monoglucuronide	Conjugation - Conjugation	Bilirubin	[183], [184]
MR007559	Bilirubin monoglucuronide	Bilirubin diglucuronide	Conjugation - Conjugation	Bilirubin	[184]
MR000383	BMS-298585	BMS-298585 metabolite M13	Unclear - Unclear	BMS-298585	[185], [186]
MR005475	BMS-986165	BMT-334616	Conjugation - N-glucuronidation	BMS-986165	[187]
MR003858	Hesperetin	Hesperetin-sulfo-O-glucuronide	Unclear - Unclear	BRN-0183227	[160]
MR000492	Bupivacaine hydrochloride	Buprenorphine glucuronide	Conjugation - Glucuronidation	Buprenorphine hydrochloride	[188], [61], [189], [190]
MR000487	Norbuprenorphine	Norbuprenorphine glucuronide	Conjugation - Glucuronidation	Buprenorphine hydrochloride	[188], [189], [190]
MR000552	Candesartan	Candesartan N2-glucuronide	Conjugation - N-Glucuronidation	Candesartan cilexetil	[71]
MR002826	Capsaicin	Capsaicin glucuronide	Conjugation - Glucuronidation	Capsaicin	[13]
MR000574	Carvedilol	Carvedilol glucuronide	Conjugation - O-Glucuronidation	Carvedilol	[191]
MR006094	CB-3304	Glucuronic acid conjugates	Conjugation - Conjugation	CB-3304	[156]
MR006253	Chloroxylenol	Glucuronic acid	Conjugation - Glucuronidation	Chloroxylenol	[171]
MR006254	Chloroxylenol	Sulfuric acid	Conjugation - Glucuronidation	Chloroxylenol	[171]
MR006564	Hydrated clofazimine	Hydrated clofazimine glucuronidation	Conjugation - Glucuronidation	Clofazimine	[62]
MR006562	Hydroxylated clofazimine	Hydroxylated clofazimine glucuronidation	Conjugation - Glucuronidation	Clofazimine	[62]
MR007435	CYC-202	CYC-202 M6	Conjugation - Glucuronidation	CYC-202	[192]
MR003222	Darolutamide	Ketodarolutamide	Oxidation - Oxidation	Darolutamide	[193], [194], [195]
MR000755	Deferasirox	Deferasirox metabolite M3	Conjugation - Glucuronidation	Deferasirox	[196]
MR000768	3-hydroxydesloratadine	3-hydroxydesloratadine O-glucuronide	Conjugation - Glucuronidation	Desloratadine	[72]
MR006617	Dolutegravir sodium	Ether glucuronide dolutegravir (M2)	Conjugation - Glucuronidation	Dolutegravir sodium	[38]
MR006688	11-Nor-9-carboxy-delta-9-THC	11-nor-9-carboxy-delta-9-THC-glucuronide	Conjugation - Glucuronidation	Dronabinol	[9]
MR006705	Phenol-dronedarone	Phenol-dronedarone glucuronide	Conjugation - Glucuronidation	Dronedarone hydrochloride	[39]
MR000896	Edaravone	Edaravone glucuronide conjugates	Conjugation - Glucuronidation	Edaravone	[197]
MR000907	Eltrombopag olamine	Eltrombopag olamine glucuronide conjugate	Conjugation - Glucuronidation	Eltrombopag olamine	[198]
MR009951	Elvitegravir	Elvitegravir Metabolite M4	Conjugation - Glucuronidation	Elvitegravir	[199]
MR009735	EM-652	EM-652-7-Glucuronide	Conjugation - Glucuronidation	EM-800	[200]
MR009736	EM-652	EM-652-4'-Glucuronide	Conjugation - Glucuronidation	EM-800	[200]
MR006868	AGI-16903	Unclear	Unclear - Unclear	Enasidenib	[98]
MR006054	ENT-1814	Phenyl glucuronide	Conjugation - Conjugation	ENT-1814	[201]
MR006053	Hydroquinone	Quinol glucuronide	Conjugation - Conjugation	ENT-1814	[201]
MR002847	Epinephrine hydrochloride	Epinephrine glucuronide metabolite	Conjugation - Glucuronidation	Epinephrine hydrochloride	[202]
MR000945	Eslicarbazepine	Eslicarbazepine-O-glucuronide metabolite	Unclear - Unclear	Eslicarbazepine acetate	[203], [204]
MR002652	Estradiol	2-Methoxyestrone 3-glucuronide	Unclear - Unclear	Estradiol cypionate	[205]
MR002653	Estradiol	17-beta-Estradiol-3-glucuronide	Unclear - Unclear	Estradiol cypionate	[205]
MR002654	Estradiol	2-methoxy-17beta-estradiol 3-O-(beta-D-glucuronide)	Unclear - Unclear	Estradiol cypionate	[205], [206]
MR002656	Estradiol	17alpha-Estradiol-3-glucuronide	Unclear - Unclear	Estradiol cypionate	[205]
MR002657	Estradiol	Estradiol-17alpha 3-D-glucuronoside	Unclear - Unclear	Estradiol cypionate	[205]
MR002658	Estradiol	17-beta-estradiol 3-sulfate-17-(beta-D-glucuronide)	Unclear - Unclear	Estradiol cypionate	[205]
MR002675	Estradiol	2-Methoxyestrone 3-glucuronide	Unclear - Unclear	Estradiol valerate	[205]
MR002676	Estradiol	17-beta-Estradiol-3-glucuronide	Unclear - Unclear	Estradiol valerate	[205]
MR002677	Estradiol	2-methoxy-17beta-estradiol 3-O-(beta-D-glucuronide)	Unclear - Unclear	Estradiol valerate	[205], [206]
MR002679	Estradiol	17alpha-Estradiol-3-glucuronide	Unclear - Unclear	Estradiol valerate	[205]
MR002680	Estradiol	Estradiol-17alpha 3-D-glucuronoside	Unclear - Unclear	Estradiol valerate	[205]
MR002681	Estradiol	17-beta-estradiol 3-sulfate-17-(beta-D-glucuronide)	Unclear - Unclear	Estradiol valerate	[205]
MR002720	Ethinyl estradiol	N-desmethylzopiclone	Conjugation - O-Glucuronidation	Ethinyl estradiol	[207]
MR007155	16alpha-methoxyethinylestradiol	16alpha-methoxyethinylestradiol-glucuronide	Conjugation - O-glucuronidation	Ethinylestradiol propanesulfonate	[109], [110]
MR007143	2-methoxyethinylestradiol	2-methoxyethinylestradiol-glucuronide	Conjugation - O-glucuronidation	Ethinylestradiol propanesulfonate	[109], [110]
MR007146	4-methoxyethinylestradiol	4-methoxyethinylestradiol-glucuronide	Conjugation - O-glucuronidation	Ethinylestradiol propanesulfonate	[109], [110]
MR007149	6-methoxyethinylestradiol	6-methoxyethinylestradiol-glucuronide	Conjugation - O-glucuronidation	Ethinylestradiol propanesulfonate	[109], [110]
MR007152	7-methoxyethinylestradiol	7-methoxyethinylestradiol-glucuronide	Conjugation - O-glucuronidation	Ethinylestradiol propanesulfonate	[109], [110]
MR007157	Ethinylestradiol propanesulfonate	Ethinylestradiol-glucuronide	Conjugation - O-glucuronidation	Ethinylestradiol propanesulfonate	[109]
MR012145	SN-38	SN-38 glucuronide	Unclear - Unclear	Etirinotecan pegol	[208]
MR000984	Etoposide	Etoposide glucuronide	Conjugation - Glucuronidation	Etoposide	[209]
MR001008	Ezetimibe	Ezetimibe-glucuronide	Conjugation - Glucuronidation	Ezetimibe	[74], [210], [211], [212]
MR009117	Favipiravir	M2 (favipiravir glucuronide conjugate)	Conjugation - Glucuronidation	Favipiravir	[213]
MR012009	Fevipiprant	AG met	Unclear - Unclear	Fevipiprant	[214], [215]
MR005044	Flurbiprofen sodium	Flurbiprofen glucuronide	Conjugation - Glucuronidation	Flurbiprofen sodium	[216]
MR002946	Formoterol	Formoterol glucuronide metabolite 1	Conjugation - O-Glucuronidation	Formoterol	[217], [27]
MR002947	Formoterol	Formoterol glucuronide metabolite 2	Conjugation - O-Glucuronidation	Formoterol	[217], [27]
MR002941	O-demethylated formoterol	O-demethylated formoterol glucuronide metabolite 2	Unclear - Unclear	Formoterol	[218], [27]
MR002942	O-demethylated formoterol	O-demethylated formoterol glucuronide metabolite 1	Unclear - Unclear	Formoterol	[218], [27]
MR003165	Hydroxyphenytoin	Hydroxyphenytoin-O-glucuronide metabolite	Unclear - Unclear	Fosphenytoin sodium	[219]
MR001099	Furosemide	Furosemide glucuronide	Conjugation - Glucuronidation	Furosemide	[220]
MR007455	FYX-051	Unclear	Conjugation - N1-Glucuronidation	FYX-051	[221]
MR007455	FYX-051	Unclear	Conjugation - N2-Glucuronidation	FYX-051	[221]
MR001125	Gemfibrozil	Gemfibrozil 1-beta-glucuronide metabolite	Conjugation - O-Glucuronidation	Gemfibrozil	[222], [9], [64]
MR005446	GSK-1265744	Cabotegravir M3	Multi-steps Reaction - Oxidationn defluorination; glutathione conjugation	GSK-1265744	[144], [223]
MR007469	GSK-1265744	GSK-1265744 M1	Conjugation - O-glucuronidation	GSK-1265744	[144]
MR007470	GSK-1265744	GSK-1265744 M2	Conjugation - O-glucuronidation	GSK-1265744	[144]
MR005979	GV-150526	Gavestinel acyl glucuronid	Conjugation - Glucuronidation	GV-150526	[9]
MR013333	Morphine	Morphine-3-glucuronide	Conjugation - Glucuronidation	Heroin	[128]
MR013332	Morphine	Morphine-6-glucuronide	Conjugation - Glucuronidation	Heroin	[128]
MR007047	Hydroxyestrone	2-hydroxyestrone 2-glucuronide	Conjugation - O-glucuronidation	Hydroxyestrone	[172]
MR012953	ICYS	Ibrutinib-S-glucuronide	Unclear - Unclear	Ibrutinib	[10]
MR004643	Ibuprofen	Ibuprofen glucuronide	Conjugation - O-glucuronidation	Ibuprofen	[44], [9]
MR001202	Indomethacin	Indomethacin acyl glucuronide	Conjugation - O-Glucuronidation	Indomethacin	[45], [224]
MR001227	SN-38	Glucuronidated Sn-38	Conjugation - Glucuronidation	Irinotecan hydrochloride	[225], [226], [227]
MR001385	Labetalol	Labetalol Benzyl glucuronide metabolite (II)	Conjugation - O-Glucuronidation	Labetalol	[19], [228]
MR001386	Labetalol	Labetalol Phenolic glucuronide metabolite (III)	Conjugation - O-Glucuronidation	Labetalol	[19], [228]
MR001387	Labetalol	Labetalol N-glucuronide metabolite	Conjugation - O-Glucuronidation	Labetalol	[19], [228]
MR003709	LAU-7b	4-HPR glucuronide	Unclear - Unclear	LAU-7b	[125]
MR003712	LCQ908-NXA	M18.4	Conjugation - Glucuronidation	LCQ908-NXA	[133], [229]
MR005523	Lenacapavir	Unclear	Unclear - Unclear	Lenacapavir	[230]
MR001443	Letermovir	Letermovir metabolite M1	Conjugation - O-Glucuronidation	Letermovir	[231]
MR008303	LJN452	LJN452 metabolite M22	Conjugation - Glucuronidation	LJN452	[141]
MR006135	LM-94	4-Methylumbelliferyl glucuronide	Conjugation - Conjugation	LM-94	[232]
MR011361	LNP023	LNP023 Metabolite M2	Conjugation - Glucuronidation	LNP023	[233], [131]
MR006903	3-Hydroxydesloratadine	3-hydroxydesloratadine O-glucuronide	Conjugation - Glucuronidation	Loratadine	[90]
MR013898	Losartan	LOG	Unclear - Unclear	Losartan	[71]
MR013899	Losartan	LN1G	Unclear - Unclear	Losartan	[71]
MR013900	Losartan	LN2G	Unclear - Unclear	Losartan	[71]
MR006915	Losartan potassium	Losartan N2-glucuronide	Conjugation - N-glucuronidation	Losartan potassium	[234]
MR006922	beta-hydroxy acid of lovastatin	6'-beta-Hydroxylovastatin	Oxidation - Hydrolyzationn	Lovastatin	[56]
MR001604	Lumiracoxib	Lumiracoxib metabolite M24	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001588	Lumiracoxib metabolite M11	Lumiracoxib metabolite M3	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001594	Lumiracoxib metabolite M12	Lumiracoxib metabolite M13	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001596	Lumiracoxib metabolite M15	Lumiracoxib metabolite M16/metabolite M17	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001600	Lumiracoxib metabolite M23	Lumiracoxib metabolite M22	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001601	Lumiracoxib metabolite M25	Lumiracoxib metabolite M20	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001593	Lumiracoxib metabolite M8	Lumiracoxib metabolite M10	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001593	Lumiracoxib metabolite M8	Lumiracoxib metabolite M10	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001593	Lumiracoxib metabolite M8	Lumiracoxib metabolite M10	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001593	Lumiracoxib metabolite M8	Lumiracoxib metabolite M10	Conjugation - Glucuronidation	Lumiracoxib	[9]
MR001651	17alpha-Ethinylestradiol	N-desmethylzopiclone metabolite	Conjugation - O-Glucuronidation	Mestranol	[109], [207], [235]
MR004804	Morphine	Morphine glucuronide	Conjugation - Glucuronidation	Morphine	[44], [49], [50]
MR004805	Morphine	Morphine-3-glucuronide	Conjugation - Glucuronidation	Morphine	[49], [44], [236]
MR009731	Motesanib	Motesanib M1	Conjugation - Glucuronidation	Motesanib	[166]
MR004815	Mycophenolate mofetil	Mycophenolic acid glucuronide	Conjugation - Glucuronidation	Mycophenolate mofetil	[237]
MR004816	Mycophenolate mofetil	Mycophenolic acyl-glucuronide (AcMPAG)	Conjugation - Glucuronidation	Mycophenolate mofetil	[237]
MR004824	Mycophenolic acid	Mycophenolic acid glucuronide	Conjugation - O-glucuronidation	Mycophenolic acid	[44], [75]
MR004873	O-Desmethylnaproxen	O-Desmethylnaproxen acyl glucuronide	Conjugation - Glucuronidation	Naproxen	[9]
MR004872	O-Desmethylnaproxen	O-Desmethylnaproxen O-glucuronide	Conjugation - Glucuronidation	Naproxen	[9]
MR001735	Niclosamide	Niclosamide-2-O-glucuronide metabolite	Conjugation - Glucuronidation	Niclosamide	[238]
MR002964	Cotinine	Cotinine glucuronide metabolite	Conjugation - Glucuronidation	Nicotine	[44]
MR002955	Nicotine	Nicotine glucuronide metabolite	Conjugation - Glucuronidation	Nicotine	[44]
MR013758	Norbuprenorphine	Norbuprenorphine metabolite M1	Unclear - Unclear	Norbuprenorphine	[61]
MR001792	Norgestrel	Norgestrel glucuronide metabolite	Conjugation - O-Glucuronidation	Norgestimate	[239]
MR013702	Opicapone	BIA 9-1106	Conjugation - Glucuronidation	Opicapone	[240]
MR008449	OTSSP167	OTS167-G	Unclear - Unclear	OTSSP167	[164]
MR002012	Acetaminophen	Acetaminophen glucuronide	Conjugation - Glucuronidation	Phenacetin	[241]
MR004467	9,10-Phenanthrene hydroquinone	O-mono-glucuronosyl catechol	Unclear - Unclear	Phenanthrenequinone	[170]
MR002031	Hydroxyphenytoin	4-hydroxyphenytoin o-glucuronide	Conjugation - O-Glucuronidation	Phenytoin	[44], [242]
MR012707	Phloretin	Unclear	Conjugation - Glucuronidation	Phloretin	[124]
MR005172	Pirprofen	Pirprofen glucuronide	Conjugation - Glucuronidation	Pirprofen	[243], [112]
MR002069	Pitavastatin	Pitavastatin glucuronide	Conjugation - Glucuronidation	Pitavastatin calcium	[77]
MR002087	Posaconazole	Posaconazole-glucuronide	Conjugation - Glucuronidation	Posaconazole	[104]
MR002151	Probenecid	Probenecid acyl glucuronide	Conjugation - Glucuronidation	Probenecid	[52], [244]
MR013649	PT2385 M10	PT2385 M1	Multi-steps Reaction - Hydroxylation; Glucuronide conjugation	PT2385	[142]
MR013647	PT2385 M2	PT2385 M11	Multi-steps Reaction - Hydroxylation; Glucuronide conjugation	PT2385	[142]
MR008594	Puerarin	Puerarin-7-O-glucuronide	Conjugation - Glucuronidation	Puerarin	[138]
MR010029	Raloxifene	Raloxifen-4-glucoronide(M2)	Conjugation - Glucuronidation	Raloxifene	[245], [246], [247]
MR010030	Raloxifene	Raloxifene-6-bate-glucuronide(M1)	Conjugation - Glucuronidation	Raloxifene	[245], [246]
MR010031	Raloxifene	Raloxifene-6, 4-diglucuronide(M3)	Conjugation - Glucuronidation	Raloxifene	[245], [246]
MR010033	Raltegravir potassium	RaltegravirCglucuronide	Unclear - Unclear	Raltegravir potassium	[248], [249]
MR013054	Repaglinide	Repaglinide M7	Conjugation - Glucuronidation	Repaglinide	[32]
MR009533	Rilpivirine M2	Rilpivirine M6	Conjugation - Glucuronidation	Rilpivirine hydrochloride	[53]
MR009545	Riociguat metabolite M1	Riociguat metabolite M4	Conjugation - N-glucuronidation	Riociguat	[78]
MR002209	Rucaparib M324 metabolite	Rucaparib M500 metabolite	Conjugation - Glucuronidation	Rucaparib	[55], [250]
MR013227	SN-38	10-O-glucuronyl-SN-38	Conjugation - O-gluccuronidation	Sacituzumab govitecan	[106]
MR002238	ACT-333679	ME9Qgl9thj	Conjugation - Glucuronidation	Selexipag	[92]
MR002893	Selinexor	Selinexor glucuronide conjugates	Conjugation - Conjugation	Selinexor	[251]
MR005262	Silymarin	20-O-beta-D-Glu	Conjugation - Glucuronidation	Silymarin	[252], [253]
MR005263	Silymarin	Silybin 7-glucoside	Conjugation - Glucuronidation	Silymarin	[252], [253]
MR013437	Simvastatin	Unclear	Unclear - Unclear	Simvastatin	[254]
MR008323	Sitafloxacin	Sitafloxacin metabolite M1	Conjugation - Glucuronidation	Sitafloxacin	[153]
MR007484	SN-38	SN-38G	Conjugation - Glucuronidation	SN-38	[255], [256]
MR002307	Suprofen	Suprofen glucuronide	Conjugation - Glucuronidation	Suprofen	[9]
MR009352	T-5224	T-5224 G3	Conjugation - Hydroxyl O-glucosidation	T-5224	[169]
MR009351	T-5224	T-5224 G2	Conjugation - Acyl O-glucosidation	T-5224	[169]
MR002354	Tecovirimat	.	Hydrolysis - Hydrolysis	Tecovirimat	[257]
MR006197	Tranilast	Tranilast glucuronide	Conjugation - Glucuronidation	Tranilast	[113], [114]
MR002465	Troglitazone	Troglitazone glucuronide metabolite	Conjugation - Glucuronidation	Troglitazone	[258], [80]
MR010912	Vericiguat	Vericiguat Metabolite M2	Conjugation - N-glucuronidation	Vericiguat	[94]
MR005667	Vorinostat	Vorinostat-O-Glucuronide metabolite	Unclear - Unclear	Vorinostat	[259], [260]
MR005675	Voxelotor	Unclear	Conjugation - Glucuronidation	Voxelotor	[96]
MR006500	(R)-Carisbamate	(R)-carisbamate glucuronide	Conjugation - Conjugation	YKP-509	[261]
MR006501	YKP-509	Carisbamate glucuronide	Conjugation - Conjugation	YKP-509	[261]


⏷ Show the Full List of 177 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.17E-01; Fold-change: 6.55E-02; Z-score: 2.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-02; Fold-change: 4.20E-01; Z-score: 3.84E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.82E-01; Fold-change: 1.47E-02; Z-score: 6.84E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.46E-01; Fold-change: 6.14E-02; Z-score: 1.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.49E-02; Fold-change: -1.03E-01; Z-score: -7.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.08E-01; Fold-change: -3.22E-02; Z-score: -3.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.66E-04; Fold-change: -4.90E-02; Z-score: -1.83E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.50E-01; Fold-change: 1.30E-02; Z-score: 5.24E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.13E-01; Fold-change: -6.34E-02; Z-score: -5.97E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.04E-04; Fold-change: -5.18E-01; Z-score: -1.68E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.49E-01; Fold-change: 7.94E-02; Z-score: 3.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.65E-03; Fold-change: -6.65E-02; Z-score: -4.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-01; Fold-change: -4.00E-02; Z-score: -2.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.18E-01; Fold-change: 4.62E-02; Z-score: 2.36E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.47E-01; Fold-change: -2.32E-02; Z-score: -1.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.08E-01; Fold-change: 7.98E-03; Z-score: 3.57E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.60E-01; Fold-change: 2.51E-02; Z-score: 8.26E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.62E-03; Fold-change: 1.37E-01; Z-score: 8.67E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.83E-07; Fold-change: 8.08E-02; Z-score: 4.11E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.98E-01; Fold-change: -5.34E-02; Z-score: -2.12E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.49E-01; Fold-change: -6.42E-02; Z-score: -2.32E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.56E-02; Fold-change: 1.55E-01; Z-score: 1.53E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.39E-02; Fold-change: 3.09E-01; Z-score: 2.24E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.79E-03; Fold-change: 2.06E-01; Z-score: 7.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.70E-05; Fold-change: -8.48E-02; Z-score: -3.30E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.09E-04; Fold-change: -6.45E-02; Z-score: -2.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.87E-02; Fold-change: -4.28E-01; Z-score: -1.94E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.75E-01; Fold-change: 9.22E-02; Z-score: 1.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.45E-01; Fold-change: -1.66E-01; Z-score: -4.71E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.94E-02; Fold-change: -7.70E-02; Z-score: -2.65E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.94E-01; Fold-change: 1.98E-02; Z-score: 9.45E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.13E-01; Fold-change: 9.54E-03; Z-score: 4.14E-02
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 2.87E-01; Fold-change: -1.92E-01; Z-score: -1.02E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.33E-02; Fold-change: 1.75E-02; Z-score: 8.91E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.69E-01; Fold-change: -2.78E-02; Z-score: -9.72E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.43E-01; Fold-change: 1.95E-02; Z-score: 3.86E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.45E-18; Fold-change: -3.01E-01; Z-score: -4.74E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.61E-11; Fold-change: 2.18E-01; Z-score: 6.73E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.74E-01; Fold-change: -1.44E-02; Z-score: -7.35E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.58E-01; Fold-change: -1.80E-02; Z-score: -5.68E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.11E-01; Fold-change: 1.85E-01; Z-score: 5.52E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.30E-01; Fold-change: -6.90E-02; Z-score: -3.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.40E-01; Fold-change: -7.00E-02; Z-score: -3.69E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.33E-18; Fold-change: 2.66E-01; Z-score: 1.10E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.21E-02; Fold-change: 2.60E-01; Z-score: 1.40E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.60E-03; Fold-change: 3.86E-01; Z-score: 8.02E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.57E-01; Fold-change: 8.93E-02; Z-score: 5.68E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.85E-03; Fold-change: -9.19E-02; Z-score: -3.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.59E-01; Fold-change: -3.65E-02; Z-score: -1.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.76E-02; Fold-change: 9.81E-02; Z-score: 4.02E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.14E-02; Fold-change: -1.16E-01; Z-score: -6.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.73E-01; Fold-change: -2.96E-02; Z-score: -1.22E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.31E-01; Fold-change: 4.72E-02; Z-score: 1.93E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.98E-04; Fold-change: -2.03E-01; Z-score: -1.30E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.83E-03; Fold-change: 2.27E-01; Z-score: 1.62E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.42E-02; Fold-change: 7.93E-02; Z-score: 4.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.04E-03; Fold-change: -7.68E-02; Z-score: -3.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.29E-02; Fold-change: 2.26E-01; Z-score: 1.23E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.66E-01; Fold-change: -1.22E-01; Z-score: -3.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.03E-01; Fold-change: 2.82E-02; Z-score: 1.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.31E-01; Fold-change: 7.20E-02; Z-score: 4.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.34E-01; Fold-change: 1.78E-02; Z-score: 1.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.19E-02; Fold-change: -3.33E-02; Z-score: -7.37E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.26E-09; Fold-change: 3.41E-01; Z-score: 4.05E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.19E-01; Fold-change: -2.73E-01; Z-score: -1.01E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.12E-01; Fold-change: 2.86E-02; Z-score: 3.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.15E-01; Fold-change: 2.28E-02; Z-score: 1.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.60E-01; Fold-change: -5.65E-02; Z-score: -4.75E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.78E-01; Fold-change: -1.53E-02; Z-score: -3.93E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.20E-01; Fold-change: -3.27E-03; Z-score: -2.84E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.39E-01; Fold-change: 4.04E-02; Z-score: 1.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.05E-01; Fold-change: -1.01E-01; Z-score: -5.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.21E-01; Fold-change: -5.04E-02; Z-score: -4.11E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.10E-01; Fold-change: 1.41E-01; Z-score: 6.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.00E-01; Fold-change: 5.79E-02; Z-score: 3.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.69E-01; Fold-change: 4.90E-02; Z-score: 1.88E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.03E-01; Fold-change: 9.92E-03; Z-score: 4.89E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.42E-01; Fold-change: -4.97E-02; Z-score: -3.73E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.03E-01; Fold-change: 8.52E-02; Z-score: 6.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.17E-02; Fold-change: 4.08E-02; Z-score: 1.59E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.87E-01; Fold-change: 4.98E-02; Z-score: 3.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.53E-01; Fold-change: 4.14E-02; Z-score: 1.83E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.92E-01; Fold-change: -9.30E-02; Z-score: -6.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-01; Fold-change: -5.91E-02; Z-score: -3.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.34E-02; Fold-change: -7.88E-02; Z-score: -1.98E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.69E-01; Fold-change: 1.91E-02; Z-score: 5.45E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.34E-01; Fold-change: -3.84E-01; Z-score: -1.29E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 8.69E-01; Fold-change: -2.40E-01; Z-score: -8.34E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.23E-01; Fold-change: -3.50E-02; Z-score: -1.96E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.06E-01; Fold-change: -3.90E-02; Z-score: -1.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.22E-04; Fold-change: 2.15E-01; Z-score: 1.22E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.61E-01; Fold-change: -6.03E-02; Z-score: -2.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.40E-01; Fold-change: 3.70E-02; Z-score: 1.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.01E-01; Fold-change: 1.93E-01; Z-score: 4.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.94E-01; Fold-change: -1.29E-01; Z-score: -8.90E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.96E-03; Fold-change: -1.95E-01; Z-score: -8.72E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.04E-02; Fold-change: -2.20E-01; Z-score: -1.16E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.86E-01; Fold-change: 5.00E-02; Z-score: 1.43E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.89E-01; Fold-change: -6.89E-02; Z-score: -2.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.84E-01; Fold-change: 2.05E-01; Z-score: 8.91E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.44E-01; Fold-change: -2.67E-02; Z-score: -1.48E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.85E-01; Fold-change: -4.31E-02; Z-score: -2.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.93E-01; Fold-change: 1.04E-02; Z-score: 8.52E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.29E-01; Fold-change: -5.44E-03; Z-score: -2.25E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.23E-03; Fold-change: 9.31E-02; Z-score: 4.30E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.80E-01; Fold-change: -9.11E-03; Z-score: -3.47E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.59E-01; Fold-change: 8.21E-02; Z-score: 5.64E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.45E-01; Fold-change: 4.29E-02; Z-score: 1.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.29E-01; Fold-change: 1.20E-01; Z-score: 4.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.43E-01; Fold-change: -1.85E-02; Z-score: -1.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.52E-01; Fold-change: -4.37E-02; Z-score: -2.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.90E-02; Fold-change: -1.23E-01; Z-score: -5.71E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.40E-01; Fold-change: -4.85E-04; Z-score: -1.69E-03
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.37E-04; Fold-change: -1.50E-01; Z-score: -9.69E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.29E-06; Fold-change: -4.82E-01; Z-score: -7.82E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.42E-21; Fold-change: 3.55E-01; Z-score: 1.33E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.47E-01; Fold-change: -1.58E-02; Z-score: -6.45E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.46E-01; Fold-change: -1.86E-02; Z-score: -8.11E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.34E-01; Fold-change: -2.43E-02; Z-score: -1.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.48E-01; Fold-change: -8.54E-03; Z-score: -6.13E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.11E-01; Fold-change: 5.03E-03; Z-score: 2.97E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.37E-01; Fold-change: -3.42E-02; Z-score: -1.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.12E-01; Fold-change: 2.06E-01; Z-score: 3.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.30E-01; Fold-change: -2.46E-02; Z-score: -9.42E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.69E-01; Fold-change: 9.30E-02; Z-score: 7.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.43E-01; Fold-change: 4.28E-02; Z-score: 2.46E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.98E-01; Fold-change: 1.01E-01; Z-score: 3.33E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.00E-02; Fold-change: 1.81E-01; Z-score: 1.77E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.91E-01; Fold-change: 7.62E-02; Z-score: 6.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.03E-02; Fold-change: 1.31E-01; Z-score: 1.81E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.43E-01; Fold-change: 1.22E-01; Z-score: 3.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
2	Functional significance of UDP-glucuronosyltransferase variants in the metabolism of active tamoxifen metabolites. Cancer Res. 2009 Mar 1;69(5):1892-900.
3	Clinical pharmacokinetics and pharmacodynamics of nintedanib. Clin Pharmacokinet. 2019 Sep;58(9):1131-1147.
4	Assessing cytochrome P450 and UDP-glucuronosyltransferase contributions to warfarin metabolism in humans. Chem Res Toxicol. 2009 Jul;22(7):1239-45.
5	Functional characterization of human and cynomolgus monkey UDP-glucuronosyltransferase 1A1 enzymes. Life Sci. 2010 Aug 14;87(7-8):261-8.
6	Metabolomics of Methylphenidate and Ethylphenidate: Implications in Pharmacological and Toxicological Effects
7	Liquid chromatography-tandem mass spectrometry method for measurement of nicotine N-glucuronide: a marker for human UGT2B10 inhibition. J Pharm Biomed Anal. 2011 Jul 15;55(5):964-71.
8	In vitro inhibition of UDP glucuronosyltransferases by atazanavir and other HIV protease inhibitors and the relationship of this property to in vivo bilirubin glucuronidation. Drug Metab Dispos. 2005 Nov;33(11):1729-39.
9	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
10	Extrahepatic metabolism of ibrutinib
11	Metabolic interaction between morphine and naloxone in human liver. A common pathway of glucuronidation? Drug Metab Dispos. 1989 Mar-Apr;17(2):218-20.
12	Drug-drug interactions for UDP-glucuronosyltransferase substrates: a pharmacokinetic explanation for typically observed low exposure (AUCi/AUC) ratios. Drug Metab Dispos. 2004 Nov;32(11):1201-8.
13	Glucuronidation of capsaicin by liver microsomes and expressed UGT enzymes: reaction kinetics, contribution of individual enzymes and marked species differences Expert Opin Drug Metab Toxicol. 2014 Oct;10(10):1325-36. doi: 10.1517/17425255.2014.954548.
14	Role of human UGT2B10 in N-glucuronidation of tricyclic antidepressants, amitriptyline, imipramine, clomipramine, and trimipramine. Drug Metab Dispos. 2010 May;38(5):863-70.
15	Characterization of rat intestinal microsomal UDP-glucuronosyltransferase activity toward mycophenolic acid. Drug Metab Dispos. 2006 Sep;34(9):1632-9.
16	Effect of aging on glucuronidation of valproic acid in human liver microsomes and the role of UDP-glucuronosyltransferase UGT1A4, UGT1A8, and UGT1A10. Drug Metab Dispos. 2009 Jan;37(1):229-36.
17	Effect of common exon variant (p.P364L) on drug glucuronidation by the human UDP-glucuronosyltransferase 1 family. Basic Clin Pharmacol Toxicol. 2011 Dec;109(6):486-93.
18	In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition. Xenobiotica. 2008 May;38(5):496-510.
19	Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
20	Metabolism and disposition of opicapone in the rat and metabolic enzymes phenotyping
21	Human UDP-glucuronosyltransferase (UGT)1A3 enzyme conjugates chenodeoxycholic acid in the liver. Hepatology. 2006 Nov;44(5):1158-70.
22	Pharmacokinetic drug interactions of morphine, codeine, and their derivatives: theory and clinical reality, Part II. Psychosomatics. 2003 Nov-Dec;44(6):515-20.
23	Inhibition of bilirubin metabolism induces moderate hyperbilirubinemia and attenuates ANG II-dependent hypertension in mice. Am J Physiol Regul Integr Comp Physiol. 2009 Sep;297(3):R738-43.
24	Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
25	Use of a human liver microsome bank in drug glucuronidation studies. Toxicol In Vitro. 1991;5(5-6):559-62.
26	Stimulation of microsomal uridine diphosphate glucuronyltransferase by glucuronic acid derivatives. Biochem J. 1974 Apr;139(1):243-9.
27	FDA Approved Drug Products: Perforomist? inhalation solution
28	Association between the UGT1A1*28 allele and hyperbilirubinemia in HIV-positive patients receiving atazanavir: a meta-analysis. Biosci Rep. 2019 May 2;39(5). pii: BSR20182105.
29	DrugBank(Pharmacology-Metabolism):Lasofoxifene
30	Human udp-glucuronosyltransferases: isoform selectivity and kinetics of 4-methylumbelliferone and 1-naphthol glucuronidation, effects of organic solvents, and inhibition by diclofenac and probenecid. Drug Metab Dispos. 2004 Apr;32(4):413-23.
31	Influence of mutations associated with Gilbert and Crigler-Najjar type II syndromes on the glucuronidation kinetics of bilirubin and other UDP-glucuronosyltransferase 1A substrates. Pharmacogenet Genomics. 2007 Dec;17(12):1017-29.
32	Repaglinide-gemfibrozil drug interaction: inhibition of repaglinide glucuronidation as a potential additional contributing mechanism. Br J Clin Pharmacol. 2010 Dec;70(6):870-80.
33	Effects of UGT1A1 genotype on the pharmacokinetics, pharmacodynamics, and toxicities of belinostat administered by 48-hour continuous infusion in patients with cancer. J Clin Pharmacol. 2016 Apr;56(4):461-73.
34	Evaluation of 3'-azido-3'-deoxythymidine, morphine, and codeine as probe substrates for UDP-glucuronosyltransferase 2B7 (UGT2B7) in human liver microsomes: specificity and influence of the UGT2B7*2 polymorphism. Drug Metab Dispos. 2003 Sep;31(9):1125-33.
35	Deferasirox pharmacogenetic influence on pharmacokinetic, efficacy and toxicity in a cohort of pediatric patients. Pharmacogenomics. 2017 Apr;18(6):539-554.
36	Impact of polymorphisms in CYP and UGT enzymes and ABC and SLCO1B1 transporters on the pharmacokinetics and safety of desvenlafaxine
37	Mechanisms of action, pharmacology and interactions of dolutegravir. Enferm Infecc Microbiol Clin. 2015 Mar;33 Suppl 1:2-8.
38	Metabolism, excretion, and mass balance of the HIV-1 integrase inhibitor dolutegravir in humans
39	DrugBank(Pharmacology-Metabolism):Dronedarone hydrochloride
40	Hepatic UDP-glucuronosyltransferase is responsible for eslicarbazepine glucuronidation. Drug Metab Dispos. 2011 Sep;39(9):1486-94.
41	DrugBank(Pharmacology-Metabolism):Eslicarbazepine acetate
42	Stereoselective glucuronidation and hydroxylation of etodolac by UGT1A9 and CYP2C9 in man. Xenobiotica. 2004 May;34(5):449-61.
43	LABEL:Exjade
44	Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
45	Contribution of UDP-glucuronosyltransferases 1A9 and 2B7 to the glucuronidation of indomethacin in the human liver. Eur J Clin Pharmacol. 2007 Mar;63(3):289-96.
46	Pharmacogenetic analysis of OATP1B1, UGT1A1, and BCRP variants in relation to the pharmacokinetics of letermovir in previously conducted clinical studies. J Clin Pharmacol. 2019 Sep;59(9):1236-1243.
47	Pharmacogenomics in drug-metabolizing enzymes catalyzing anticancer drugs for personalized cancer chemotherapy. Curr Drug Metab. 2007 Aug;8(6):554-62.
48	Contribution of UDP-glucuronosyltransferase 1A1 and 1A8 to morphine-6-glucuronidation and its kinetic properties. Drug Metab Dispos. 2008 Apr;36(4):688-94.
49	Metabolism and pharmacokinetics of morphine in neonates: A review
50	Morphine metabolism, transport and brain disposition
51	Identification and characterization of oxymetazoline glucuronidation in human liver microsomes: evidence for the involvement of UGT1A9. J Pharm Sci. 2011 Feb;100(2):784-93.
52	Modulation of 3'-azido-3'-deoxythymidine catabolism by probenecid and acetaminophen in freshly isolated rat hepatocytes. Biochem Pharmacol. 1991 Sep 12;42(7):1475-80.
53	Human biotransformation of the nonnucleoside reverse transcriptase inhibitor rilpivirine and a cross-species metabolism comparison. Antimicrob Agents Chemother. 2013 Oct;57(10):5067-79.
54	Involvement of human CYP1A isoenzymes in the metabolism and drug interactions of riluzole in vitro. J Pharmacol Exp Ther. 1997 Sep;282(3):1465-72.
55	Evaluation of absorption, distribution, metabolism, and excretion of [(14)C]-rucaparib, a poly(ADP-ribose) polymerase inhibitor, in patients with advanced solid tumors Invest New Drugs. 2020 Jun;38(3):765-775. doi: 10.1007/s10637-019-00815-2.
56	Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
57	Product characteristics of Triumeq.
58	In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
59	Pharmacogenomics in aspirin intolerance. Curr Drug Metab. 2009 Nov;10(9):998-1008.
60	Atorvastatin glucuronidation is minimally and nonselectively inhibited by the fibrates gemfibrozil, fenofibrate, and fenofibric acid. Drug Metab Dispos. 2007 Aug;35(8):1315-24.
61	Contribution of the different UDP-glucuronosyltransferase (UGT) isoforms to buprenorphine and norbuprenorphine metabolism and relationship with the main UGT polymorphisms in a bank of human liver microsomes. Drug Metab Dispos. 2010 Jan;38(1):40-5.
62	Characterization of Clofazimine Metabolism in Human Liver Microsomal Incubation In Vitro
63	Steroid glucuronides: human circulatory levels and formation by LNCaP cells. J Steroid Biochem Mol Biol. 1991;40(4-6):593-8.
64	The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver. Drug Metab Dispos. 2007 Nov;35(11):2040-4.
65	Characterization of Enzymes Involved in Nintedanib Metabolism in Humans
66	FDA Label of Liothyronine sodium. The 2020 official website of the U.S. Food and Drug Administration.
67	Substrate-dependent modulation of UDP-glucuronosyltransferase 1A1 (UGT1A1) by propofol in recombinant human UGT1A1 and human liver microsomes. Basic Clin Pharmacol Toxicol. 2007 Sep;101(3):211-4.
68	FDA label of Tecovirimat. The 2020 official website of the U.S. Food and Drug Administration.
69	Effect of UDP-glucuronosyltransferase (UGT) 1A polymorphism (rs8330 and rs10929303) on glucuronidation status of acetaminophen. Dose Response. 2017 Sep 11;15(3):1559325817723731.
70	Binimetinib - European Medicines Agency - European Union
71	The human UDP-glucuronosyltransferase UGT1A3 is highly selective towards N2 in the tetrazole ring of losartan, candesartan, and zolarsartan. Biochem Pharmacol. 2008 Sep 15;76(6):763-72.
72	A long-standing mystery solved: the formation of 3-hydroxydesloratadine is catalyzed by CYP2C8 but prior glucuronidation of desloratadine by UDP-glucuronosyltransferase 2B10 is an obligatory requirement Drug Metab Dispos. 2015 Apr;43(4):523-33. doi: 10.1124/dmd.114.062620.
73	UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for etoposide glucuronidation in human liver and intestinal microsomes: structural characterization of phenolic and alcoholic glucuronides of etoposide and estimation of enzyme kinetics. Drug Metab Dispos. 2007 Mar;35(3):371-80.
74	Ezetimibe: a review of its metabolism, pharmacokinetics and drug interactions. Clin Pharmacokinet. 2005;44(5):467-94.
75	The main role of UGT1A9 in the hepatic metabolism of mycophenolic acid and the effects of naturally occurring variants
76	Identification of the UDP-glucuronosyltransferase isoforms involved in mycophenolic acid phase II metabolism. Drug Metab Dispos. 2005 Jan;33(1):139-46.
77	Metabolic fate of pitavastatin, a new inhibitor of HMG-CoA reductase: human UDP-glucuronosyltransferase enzymes involved in lactonization. Xenobiotica. 2003 Jan;33(1):27-41.
78	Clinical Pharmacokinetic and Pharmacodynamic Profile of Riociguat
79	FDA label of Selinexor. The 2020 official website of the U.S. Food and Drug Administration.
80	Troglitazone glucuronidation in human liver and intestine microsomes: high catalytic activity of UGT1A8 and UGT1A10. Drug Metab Dispos. 2002 Dec;30(12):1462-9.
81	Interindividual variability in pharmacokinetics of generic nucleoside reverse transcriptase inhibitors in TB/HIV-coinfected Ghanaian patients: UGT2B7*1c is associated with faster zidovudine clearance and glucuronidation. J Clin Pharmacol. 2009 Sep;49(9):1079-90.
82	Cerivastatin, genetic variants, and the risk of rhabdomyolysis. Pharmacogenet Genomics. 2011 May;21(5):280-8.
83	Differential effects of phenobarbital on ester and ether glucuronidation of diflunisal in rats. J Pharmacol Exp Ther. 1987 Sep;242(3):1013-8.
84	A novel administration route for edaravone: I. Effects of metabolic inhibitors on skin permeability of edaravone. Int J Pharm. 2009 May 8;372(1-2):33-8.
85	Eltrombopag-induced acute liver failure in a pediatric patient: a pharmacokinetic and pharmacogenetic analysis. Ther Drug Monit. 2018 Aug;40(4):386-388.
86	Elvitegravir for the treatment of HIV infection. Drugs Today (Barc). 2014 Mar;50(3):209-17.
87	Predominant contribution of UDP-glucuronosyltransferase 2B7 in the glucuronidation of racemic flurbiprofen in the human liver. Drug Metab Dispos. 2007 Jul;35(7):1182-7.
88	Involvement of phase II enzymes and efflux transporters in the metabolism and absorption of naringin, hesperidin and their aglycones in rats
89	Is maternal opioid use hazardous to breast-fed infants? Clin Toxicol (Phila). 2012 Jan;50(1):1-14.
90	Advances in high-resolution MS and hepatocyte models solve a long-standing metabolism challenge: the loratadine story. Bioanalysis. 2016 Aug;8(16):1645-62.
91	Evidence for oxazepam as an in vivo probe of UGT2B15: oxazepam clearance is reduced by UGT2B15 D85Y polymorphism but unaffected by UGT2B17 deletion. Br J Clin Pharmacol. 2009 Nov;68(5):721-30.
92	FDA LABEL:elexipag
93	Actual and Predicted Pharmacokinetic Interactions Between Anticonvulsants and Antiretrovirals.
94	Vericiguat: A New Hope for Heart Failure Patients
95	A pharmacogenetic study of vorinostat glucuronidation. Pharmacogenet Genomics. 2010 Oct;20(10):638-41.
96	FDA Approved Drug Products:Oxbryta (voxelotor) tablets
97	Delafloxacin: place in therapy and review of microbiologic, clinical and pharmacologic properties. Infect Dis Ther. 2018 Jun;7(2):197-217.
98	FDA:Enasidenib
99	Inactivation of the pure antiestrogen fulvestrant and other synthetic estrogen molecules by UDP-glucuronosyltransferase 1A enzymes expressed in breast tissue. Mol Pharmacol. 2006 Mar;69(3):908-20.
100	The glucuronidation of Delta4-3-Keto C19- and C21-hydroxysteroids by human liver microsomal and recombinant UDP-glucuronosyltransferases (UGTs): 6alpha- and 21-hydroxyprogesterone are selective substrates for UGT2B7. Drug Metab Dispos. 2007 Mar;35(3):363-70.
101	Use of indacaterol for the treatment of COPD: a pharmacokinetic evaluation. Expert Opin Drug Metab Toxicol. 2014 Jan;10(1):129-37.
102	DrugBank(Pharmacology-Metabolism):Lenacapavir
103	In vivo chronic exposure to heroin or naltrexone selectively inhibits liver microsome formation of estradiol-3-glucuronide in the rat. Biochem Pharmacol. 2008 Sep 1;76(5):672-9.
104	Identification of human UDP-glucuronosyltransferase enzyme(s) responsible for the glucuronidation of posaconazole (Noxafil). Drug Metab Dispos. 2004 Feb;32(2):267-71.
105	Successful tacrolimus treatment following renal transplant in a HIV-infected patient with raltegravir previously treated with a protease inhibitor based regimen. Drug Metabol Drug Interact. 2011;26(3):139-41.
106	New Insights into SN-38 Glucuronidation: Evidence for the Important Role of UDP Glucuronosyltransferase 1A9
107	The impact of pharmacogenetics of metabolic enzymes and transporters on the pharmacokinetics of telmisartan in healthy volunteers. Pharmacogenet Genomics. 2011 Sep;21(9):523-30.
108	Solid-phase synthesis of drug glucuronides by immobilized glucuronosyltransferase. J Med Chem. 1976 May;19(5):679-83.
109	Genetic variation in the first-pass metabolism of ethinylestradiol, sex hormone binding globulin levels and venous thrombosis risk Eur J Intern Med. 2017 Jul;42:54-60. doi: 10.1016/j.ejim.2017.05.019.
110	Metabolism of 17 alpha-ethinylestradiol by human liver microsomes in vitro: aromatic hydroxylation and irreversible protein binding of metabolites J Clin Endocrinol Metab. 1974 Dec;39(6):1072-80. doi: 10.1210/jcem-39-6-1072.
111	Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans
112	Glucuronidation of 2-arylpropionic acids pirprofen, flurbiprofen, and ibuprofen by liver microsomes. Drug Metab Dispos. 1990 Sep-Oct;18(5):692-7.
113	Glucuronidation of antiallergic drug, Tranilast: identification of human UDP-glucuronosyltransferase isoforms and effect of its phase I metabolite. Drug Metab Dispos. 2007 Apr;35(4):583-9.
114	Simultaneous determination of tranilast and metabolites in plasma and urine using high-performance liquid chromatography
115	UDP-glucuronosyltransferase 2B15 (UGT2B15) and UGT2B17 enzymes are major determinants of the androgen response in prostate cancer LNCaP cells. J Biol Chem. 2007 Nov 16;282(46):33466-74.
116	Inhibition of UDP-glucuronyltransferase activity in rat liver microsomes by pyrimidine derivatives. Comp Biochem Physiol C Pharmacol Toxicol Endocrinol. 1995 Nov;112(3):321-5.
117	N-Glucuronidation of the antiepileptic drug retigabine: results from studies with human volunteers, heterologously expressed human UGTs, human liver, kidney, and liver microsomal membranes of Crigler-Najjar type II. Metabolism. 2006 Jun;55(6):711-21.
118	Role of UDP-glucuronosyltransferase 1A1 in the metabolism and pharmacokinetics of silymarin flavonolignans in patients with HCV and NAFLD. Molecules. 2017 Jan 15;22(1). pii: E142.
119	UGT1A1*28 polymorphism influences glucuronidation of bazedoxifene. Pharmazie. 2015 Feb;70(2):94-6.
120	Inversion of the anomeric configuration of the transferred sugar during inactivation of the macrolide antibiotic oleandomycin catalyzed by a macrolide glycosyltransferase. FEBS Lett. 2000 Jul 7;476(3):186-9.
121	Physiologically Based Pharmacokinetic Modeling for Selumetinib to Evaluate Drug-Drug Interactions and Pediatric Dose Regimens
122	DrugBank(Pharmacology-Metabolism):AKB-6548
123	Characterization of the UDP glucuronosyltransferase activity of human liver microsomes genotyped for the UGT1A1*28 polymorphism. Drug Metab Dispos. 2007 Dec;35(12):2270-80.
124	Differential and special properties of the major human UGT1-encoded gastrointestinal UDP-glucuronosyltransferases enhance potential to control chemical uptake. J Biol Chem. 2004 Jan 9;279(2):1429-41.
125	Characterization of the metabolism of fenretinide by human liver microsomes, cytochrome P450 enzymes and UDP-glucuronosyltransferases. Br J Pharmacol. 2011 Feb;162(4):989-99.
126	Metabolism and disposition of the SGLT2 inhibitor bexagliflozin in rats, monkeys and humans
127	Fusidic acid inhibits hepatic transporters and metabolic enzymes: potential cause of clinical drug-drug interaction observed with statin coadministration. Antimicrob Agents Chemother. 2016 Sep 23;60(10):5986-94.
128	PharmGKB:Heroin
129	Blonanserin: a review of its use in the management of schizophrenia
130	Carisbamate addon therapy for drugresistant partial epilepsy. The Cochrane Library. John Wiley Sons, Ltd, 2016.
131	Absorption, Distribution, Metabolism, and Excretion of [(14)C]iptacopan in Healthy Male Volunteers and in In Vivo and In Vitro Studies
132	Etirinotecan pegol in women with recurrent platinum-resistant or refractory ovarian cancer
133	Pradigastat disposition in humans: in vivo and in vitro investigations. Xenobiotica. 2017 Dec;47(12):1077-1089.
134	Carboxyl-glucuronidation of mitiglinide by human UDP-glucuronosyltransferases. Biochem Pharmacol. 2007 Jun 1;73(11):1842-51.
135	DrugBank(Pharmacology-Metabolism):Ag-221
136	UGT1A1*28 is associated with decreased systemic exposure of atorvastatin lactone. Mol Diagn Ther. 2013 Aug;17(4):233-7.
137	Identification of aspartic acid and histidine residues mediating the reaction mechanism and the substrate specificity of the human UDP-glucuronosyltransferases 1A. J Biol Chem. 2007 Dec 14;282(50):36514-24.
138	UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for puerarin metabolism in human liver microsomes
139	Involvement of UDP-glucuronosyltransferases in the extensive liver and intestinal first-pass metabolism of flavonoid baicalein
140	Identification and preliminary characterization of UDP-glucuronosyltransferases catalyzing formation of ethyl glucuronide. Anal Bioanal Chem. 2014 Apr;406(9-10):2325-32.
141	Evaluation of the Absorption, Metabolism, and Excretion of a Single Oral 1-mg Dose of Tropifexor in Healthy Male Subjects and the Concentration Dependence of Tropifexor Metabolism
142	Metabolic Profiling of the Novel Hypoxia-Inducible Factor 2 Inhibitor PT2385 In Vivo and In Vitro
143	Paracetamol glucuronidation by recombinant rat and human phenol UDP-glucuronosyltransferases. Biochem Pharmacol. 1993 May 5;45(9):1809-14.
144	Disposition and metabolism of cabotegravir: a comparison of biotransformation and excretion between different species and routes of administration in humans. Xenobiotica. 2016;46(2):147-62.
145	Pharmacokinetics and metabolism of AMG 232, a novel orally bioavailable inhibitor of the MDM2-p53 interaction, in rats, dogs and monkeys: in vitro-in vivo correlation
146	Human metabolism of nebicapone (BIA 3-202), a novel catechol-o-methyltransferase inhibitor: characterization of in vitro glucuronidation
147	S-equol glucuronidation in liver and intestinal microsomes of humans, monkeys, dogs, rats, and mice
148	Preclinical discovery of candidate genes to guide pharmacogenetics during phase I development: the example of the novel anticancer agent ABT-751. Pharmacogenet Genomics. 2013 Jul;23(7):374-81.
149	Metabolic pathways of the camptothecin analog AR-67
150	Induction and inhibition of cicletanine metabolism in cultured hepatocytes and liver microsomes from rats. Fundam Clin Pharmacol. 2000 Sep-Oct;14(5):509-18.
151	A first-in-Asian phase 1 study to evaluate safety, pharmacokinetics and clinical activity of VS-6063, a focal adhesion kinase (FAK) inhibitor in Japanese patients with advanced solid tumors
152	Drug-drug interaction of atazanavir on UGT1A1-mediated glucuronidation of molidustat in human
153	Acyl glucuronidation of fluoroquinolone antibiotics by the UDP-glucuronosyltransferase 1A subfamily in human liver microsomes
154	Effects of green tea compounds on irinotecan metabolism. Drug Metab Dispos. 2007 Feb;35(2):228-33.
155	Glucuronidation of active tamoxifen metabolites by the human UDP glucuronosyltransferases. Drug Metab Dispos. 2007 Nov;35(11):2006-14.
156	Metabolic map and bioactivation of the anti-tumour drug noscapine
157	In vitro inhibitory effects of non-steroidal anti-inflammatory drugs on 4-methylumbelliferone glucuronidation in recombinant human UDP-glucuronosyltransferase 1A9--potent inhibition by niflumic acid. Biopharm Drug Dispos. 2006 Jan;27(1):1-6.
158	Metabolism Of Antiretroviral Drugs Used In Hiv Preexposure Prophylaxis
159	Metabolism and excretion of capravirine, a new non-nucleoside reverse transcriptase inhibitor, alone and in combination with ritonavir in healthy volunteers. Drug Metab Dispos. 2004 Jul;32(7):689-98.
160	Stratification of Volunteers According to Flavanone Metabolite Excretion and Phase II Metabolism Profile after Single Doses of 'Pera' Orange and 'Moro' Blood Orange Juices
161	Bictegravir, a novel integrase inhibitor for the treatment of HIV infection. Drugs Today (Barc). 2019 Nov;55(11):669-682.
162	Phase I clinical and pharmacogenetic study of weekly TAS-103 in patients with advanced cancer. J Clin Oncol. 2001 Apr 1;19(7):2084-90.
163	Chemical and enzyme-assisted syntheses of norbuprenorphine-3--D-glucuronide
164	Glucuronidation of OTS167 in Humans Is Catalyzed by UDP-Glucuronosyltransferases UGT1A1, UGT1A3, UGT1A8, and UGT1A10
165	Identification of human UDP-glucuronosyltransferase responsible for the glucuronidation of niflumic acid in human liver. Pharm Res. 2006 Jul;23(7):1502-8.
166	In vitro metabolism of the novel, highly selective oral angiogenesis inhibitor motesanib diphosphate in preclinical species and in humans
167	Metabolism of 1,8-cineole by human cytochrome P450 enzymes: identification of a new hydroxylated metabolite. Biochim Biophys Acta. 2005 Apr 15;1722(3):304-11. doi: 10.1016/j.bbagen.2004.12.019.
168	Performance comparison between multienzymes loaded single and dual electrodes for the simultaneous electrochemical detection of adenosine and metabolites in cancerous cells. Biosens Bioelectron. 2018 Jun 30;109:263-271. doi: 10.1016/j.bios.2018.03.031.
169	Metabolism of the c-Fos/activator protein-1 inhibitor T-5224 by multiple human UDP-glucuronosyltransferase isoforms
170	Metabolism of a representative oxygenated polycyclic aromatic hydrocarbon (PAH) phenanthrene-9,10-quinone in human hepatoma (HepG2) cells
171	Fate of halogenated phenols in the organism
172	Structural and functional studies of UDP-glucuronosyltransferases. Drug Metab Rev. 1999 Nov;31(4):817-99.
173	Molecular structure of galactokinase J Biol Chem. 2003 Aug 29;278(35):33305-11. doi: 10.1074/jbc.M304789200.
174	Absorption, disposition, metabolism, and excretion of [3-(14)C]caffeic acid in rats
175	Simultaneous quantification of abemaciclib and its active metabolites in human and mouse plasma by UHPLC-MS/MS J Pharm Biomed Anal. 2021 Sep 5;203:114225. doi: 10.1016/j.jpba.2021.114225.
176	Application of a Volumetric Absorptive Microsampling (VAMS)-Based Method for the Determination of Paracetamol and Four of its Metabolites as a Tool for Pharmacokinetic Studies in Obese and Non-Obese Patients. Clin Pharmacokinet. 2022 Dec;61(12):1719-1733. doi: 10.1007/s40262-022-01187-2.
177	Evaluation of urinary acetaminophen metabolites and its association with the genetic polymorphisms of the metabolising enzymes, and serum acetaminophen concentrations in preterm neonates with patent ductus arteriosus. Xenobiotica. 2021 Nov;51(11):1335-1342. doi: 10.1080/00498254.2021.1982070.
178	Enzymatic production of alpha-D-galactose 1-phosphate by lactose phosphorolysis Biotechnol Lett. 2009 Dec;31(12):1873-7. doi: 10.1007/s10529-009-0087-1.
179	The Antifungal Effects of Citral on Magnaporthe oryzae Occur via Modulation of Chitin Content as Revealed by RNA-Seq Analysis. J Fungi (Basel). 2021 Nov 29;7(12):1023. doi: 10.3390/jof7121023.
180	In Vitro Kinetic Characterization of Axitinib Metabolism
181	Hepatic metabolism and disposition of baicalein via the coupling of conjugation enzymes and transporters-in vitro and in vivo evidences
182	Oxazolidinones as versatile scaffolds in medicinal chemistry
183	UGT1A1 dysfunction increases liver burden and aggravates hepatocyte damage caused by long-term bilirubin metabolism disorder
184	Monthly variation in the plasma copper and zinc concentration of pregnant and non-pregnant mares
185	Involvement of multiple cytochrome P450 and UDP-glucuronosyltransferase enzymes in the in vitro metabolism of muraglitazar. Drug Metab Dispos. 2007 Jan;35(1):139-49.
186	Glucuronidation as a major metabolic clearance pathway of 14c-labeled muraglitazar in humans: metabolic profiles in subjects with or without bile collection Drug Metab Dispos. 2006 Mar;34(3):427-39. doi: 10.1124/dmd.105.007617.
187	DrugBank(Pharmacology-Metabolism):Deucravacitinib
188	In vitro metabolism study of buprenorphine: evidence for new metabolic pathways. Drug Metab Dispos. 2005 May;33(5):689-95.
189	Interaction between buprenorphine and norbuprenorphine in neonatal opioid withdrawal syndrome. Drug Alcohol Depend. 2023 Jun 21;249:110832. doi: 10.1016/j.drugalcdep.2023.110832.
190	Determination of buprenorphine, norbuprenorphine, naloxone, and their glucuronides in urine by liquid chromatography-tandem mass spectrometry. Drug Test Anal. 2021 Sep;13(9):1658-1667. doi: 10.1002/dta.3104.
191	Metabolism of carvedilol in dogs, rats, and mice Drug Metab Dispos. 1998 Oct;26(10):958-69.
192	Metabolism of the trisubstituted purine cyclin-dependent kinase inhibitor seliciclib (R-roscovitine) in vitro and in vivo. Drug Metab Dispos. 2008 Mar;36(3):561-70.
193	Clinical Development of Darolutamide: A Novel Androgen Receptor Antagonist for the Treatment of Prostate Cancer Clin Genitourin Cancer. 2018 Oct;16(5):332-340. doi: 10.1016/j.clgc.2018.07.017.
194	Drug-Drug Interaction Study to Evaluate the Pharmacokinetics, Safety, and Tolerability of Ipatasertib in Combination with Darolutamide in Patients with Advanced Prostate Cancer. Pharmaceutics. 2022 Oct 1;14(10):2101. doi: 10.3390/pharmaceutics14102101.
195	Clinical Pharmacokinetics of the Androgen Receptor Inhibitor Darolutamide in Healthy Subjects and Patients with Hepatic or Renal Impairment. Clin Pharmacokinet. 2022 Apr;61(4):565-575. doi: 10.1007/s40262-021-01078-y.
196	Pharmacokinetics, metabolism, and disposition of deferasirox in beta-thalassemic patients with transfusion-dependent iron overload who are at pharmacokinetic steady state Drug Metab Dispos. 2010 May;38(5):808-16. doi: 10.1124/dmd.109.030833.
197	LABEL:ADICAVA- edaravone injection RADICAVA ORS- edaravone kit
198	Eltrombopag for use in children with immune thrombocytopenia. Blood Adv. 2018 Feb 27;2(4):454-461.
199	In vitro resistance selections using elvitegravir, raltegravir, and two metabolites of elvitegravir M1 and M4
200	Glucuronidation of the nonsteroidal antiestrogen EM-652 (SCH 57068), by human and monkey steroid conjugating UDP-glucuronosyltransferase enzymes
201	Cytochrome P450 isozymes involved in the metabolism of phenol, a benzene metabolite. Toxicol Lett. 2001 Dec 15;125(1-3):117-23.
202	LABEL:?ARTICAINE HYDROCHLORIDE AND EPINEPHRINE injection, solution
203	Pharmacokinetics and drug interactions of eslicarbazepine acetate Epilepsia. 2012 Jun;53(6):935-46. doi: 10.1111/j.1528-1167.2012.03519.x.
204	Key factors in the discovery and development of new antiepileptic drugs Nat Rev Drug Discov. 2010 Jan;9(1):68-82. doi: 10.1038/nrd2997.
205	The metabolism of estradiol; oral compared to intravenous administration J Steroid Biochem. 1985 Dec;23(6A):1065-70. doi: 10.1016/0022-4731(85)90068-8.
206	Profiling endogenous serum estrogen and estrogen-glucuronides by liquid chromatography-tandem mass spectrometry Anal Chem. 2009 Dec 15;81(24):10143-8. doi: 10.1021/ac9019126.
207	Human bilirubin UDP-glucuronosyltransferase catalyzes the glucuronidation of ethinylestradiol Mol Pharmacol. 1993 Apr;43(4):649-54.
208	Integrated population pharmacokinetics of etirinotecan pegol and its four metabolites in cancer patients with solid tumors
209	DrugBank(Pharmacology-Metabolism)Etoposide
210	Bioequivalence Study of Ezetimibe Tablets After a Single Oral Dose of 10?mg in Healthy Japanese Subjects Under Fasting Conditions. Clin Pharmacol Drug Dev. 2023 Apr 6. doi: 10.1002/cpdd.1245.
211	Pharmacokinetics and bioequivalence of Ezetimibe tablet versus Ezetrol?:an open-label, randomized, two-sequence crossover study in healthy Chinese subjects. BMC Pharmacol Toxicol. 2023 Feb 3;24(1):7. doi: 10.1186/s40360-023-00649-y.
212	Investigation of the discriminatory ability of analytes for the bioequivalence assessment of ezetimibe: Parent drug, metabolite, total form, and combination of parent drug and total form. Eur J Pharm Sci. 2022 Jul 1;174:106192. doi: 10.1016/j.ejps.2022.106192.
213	DrugBank(Pharmacology-Metabolism):Favipiravir
214	Clinical Investigation of Metabolic and Renal Clearance Pathways Contributing to the Elimination of Fevipiprant Using Probenecid as Perpetrator. Drug Metab Dispos. 2021 May;49(5):389-394. doi: 10.1124/dmd.120.000273.
215	Fevipiprant has a low risk of influencing co-medication pharmacokinetics: Impact on simvastatin and rosuvastatin in different SLCO1B1 genotypes
216	DrugBank(Pharmacology-Metabolism):Flurbiprofen
217	Mass balance and metabolism of [(3)H]Formoterol in healthy men after combined i.v. and oral administration-mimicking inhalation Drug Metab Dispos. 1999 Oct;27(10):1104-16.
218	DrugBank : Formoterol
219	U. S. FDA Label -Fosphenytoin sodium
220	High-performance liquid chromatographic determination and identification of acyl migration and photodegradation products of furosemide 1-O-acyl glucuronide J Chromatogr B Biomed Sci Appl. 1998 Oct 23;718(1):153-62. doi: 10.1016/s0378-4347(98)00357-0.
221	DrugBank(Pharmacology-Metabolism):FYX-051
222	Intracellular pharmacokinetics of gemcitabine, its deaminated metabolite 2',2'-difluorodeoxyuridine and their nucleotides Br J Clin Pharmacol. 2018 Jun;84(6):1279-1289. doi: 10.1111/bcp.13557.
223	Correction to "Mechanistic Basis of Cabotegravir-Glucuronide Disposition in Humans"
224	Herb-drug interaction in the protective effect of Alpinia officinarum against gastric injury induced by indomethacin based on pharmacokinetic, tissue distribution and excretion studies in rats. J Pharm Anal. 2021 Apr;11(2):200-209. doi: 10.1016/j.jpha.2020.05.009.
225	Pharmacokinetics, metabolism, and excretion of irinotecan (CPT-11) following I.V. infusion of [(14)C]CPT-11 in cancer patients Drug Metab Dispos. 2000 Apr;28(4):423-33.
226	Transporter and metabolic enzyme-mediated intra-enteric circulation of SN-38, an active metabolite of irinotecan: A new concept. Biochem Biophys Res Commun. 2023 Jul 12;665:19-25. doi: 10.1016/j.bbrc.2023.04.109.
227	Opioid-induced microbial dysbiosis disrupts irinotecan (CPT-11) metabolism and increases gastrointestinal toxicity in a murine model. Br J Pharmacol. 2023 May;180(10):1362-1378. doi: 10.1111/bph.16020.
228	Pregnancy-Related Hormones Increase UGT1A1-Mediated Labetalol Metabolism in Human Hepatocytes Front Pharmacol. 2021 Apr 15;12:655320. doi: 10.3389/fphar.2021.655320.
229	#N/A
230	FDA label:Lenacapavir
231	LABEL:PREVYMIS- letermovir tablet, film coated PREVYMIS- letermovir injection, solution
232	Comparisons of detections, stabilities, and kinetics of degradation of hymecromone and its glucuronide and sulfate metabolites
233	Pharmacokinetics and metabolism of LNP023 in rats by liquid chromatography combined with electrospray ionization-tandem mass spectrometry
234	Clinical pharmacokinetics of losartan. Clin Pharmacokinet. 2005;44(8):797-814.
235	The potent inhibition of human cytosolic sulfotransferase 1A1 by 17-ethinylestradiol is due to interactions with isoleucine 89 on loop 1 Horm Mol Biol Clin Investig. 2014 Dec;20(3):81-90. doi: 10.1515/hmbci-2014-0028.
236	Presence of morphine metabolites in human cerebrospinal fluid after intracerebroventricular administration of morphine
237	PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
238	Metabolism of the anthelmintic drug niclosamide by cytochrome P450 enzymes and UDP-glucuronosyltransferases: metabolite elucidation and main contributions from CYP1A2 and UGT1A1 Xenobiotica. 2016;46(1):1-13. doi: 10.3109/00498254.2015.1047812.
239	DrugBank(Pharmacology-Metabolism)Norgestimate
240	Pharmacokinetics, pharmacodynamics and tolerability of opicapone, a novel catechol-O-methyltransferase inhibitor, in healthy subjects: prediction of slow enzyme-inhibitor complex dissociation of a short-living and very long-acting inhibitor
241	DrugBank(Pharmacology-Metabolism)Phenacetin
242	Biotransformation of phenytoin in the electrochemically-driven CYP2C19 system. Biophys Chem. 2022 Dec;291:106894. doi: 10.1016/j.bpc.2022.106894.
243	High-performance liquid chromatographic determination of pirprofen and five of its metabolites in human plasma without hydrolysis and in human urine before and after chemical hydrolysis
244	The metabolism of probenecid in man Ann N Y Acad Sci. 1971 Jul 6;179:399-402. doi: 10.1111/j.1749-6632.1971.tb46916.x.
245	Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9
246	Determination of raloxifene and its glucuronides in human urine by liquid chromatography-tandem mass spectrometry assay
247	Pharmacokinetics of raloxifene and its clinical application
248	Quantification of the HIV-integrase inhibitor raltegravir and detection of its main metabolite in human plasma, dried blood spots and peripheral blood mononuclear cell lysate by means of high-performance liquid chromatography tandem mass spectrometry
249	Impact of UGT1A1 polymorphisms on Raltegravir and its glucuronide plasma concentrations in a cohort of HIV-1 infected patients
250	Pharmacokinetics and safety of rucaparib in patients with advanced solid tumors and hepatic impairment. Cancer Chemother Pharmacol. 2021 Aug;88(2):259-270. doi: 10.1007/s00280-021-04278-2.
251	Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
252	Evidence for differences in regioselective and stereoselective glucuronidation of silybin diastereomers from milk thistle (Silybum marianum) by human UDP-glucuronosyltransferases
253	Metabolism, Transport and Drug-Drug Interactions of Silymarin
254	Simvastatin Tablet, Film-Coated
255	Clinical pharmacokinetics and metabolism of irinotecan (CPT-11)
256	Individualization of Irinotecan Treatment: A Review of Pharmacokinetics, Pharmacodynamics, and Pharmacogenetics
257	LABEL:POXX- tecovirimat monohydrate injection, solution, concentrate TPOXX- tecovirimat monohydrate capsule
258	Clinical pharmacokinetics of troglitazone Clin Pharmacokinet. 1999 Aug;37(2):91-104. doi: 10.2165/00003088-199937020-00001.
259	Stability studies of vorinostat and its two metabolites in human plasma, serum and urine
260	Uridine 5'-diphospho-glucuronosyltransferase genetic polymorphisms and response to cancer chemotherapy. Future Oncol. 2010 Apr;6(4):563-85.
261	Pharmacokinetics of carisbamate (RWJ-333369) in healthy Japanese and Western subjects

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.