Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0018)
DME Name Cytochrome P450 2C8 (CYP2C8), Homo sapiens
Synonyms Cytochrome P450 family 2 subfamily C member 8; Cytochrome P450 IIC2; Cytochrome P450 MP-12; Cytochrome P450 MP-20; Cytochrome P450 form 1; S-mephenytoin 4-hydroxylase; CYP2C8; CYPIIC8
Gene Name CYP2C8
UniProt ID
CP2C8_HUMAN
Gene ID
1558
EC Number    EC: 1.14.14.1     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Microbiome and DME (MICBIO)                       
Jump to Detailed Interactome Data                      
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
Structure
1PQ2 ; 2NNH ; 2NNI ; 2NNJ ; 2VN0
Pathway Arachidonic acid metabolism (hsa00590 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Linoleic acid metabolism (hsa00591 )
Metabolic pathways (hsa01100 )
Retinol metabolism (hsa00830 )
Serotonergic synapse (hsa04726 )
Function This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. It primarily catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) with a preference for the last double bond and catalyzes the hydroxylation of carbon-hydrogen bonds. It also metabolizes all trans-retinoic acid toward its 4-hydroxylated form and displays 16-alpha hydroxylase activity toward estrogen steroid hormones, 17beta-estradiol (E2) and estrone (E1). In addition, it plays a role in the oxidative metabolism of xenobiotics. It is the principal enzyme responsible for the metabolism of the anti-cancer drug paclitaxel (taxol).
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:      166 Drugs
Thalidomide
 Drug Info Approved Breast cancer ICD11: 2C60 [1]
Warfarin sodium
 Drug Info Approved Atrial fibrillation ICD11: BC81 [2]
Estradiol acetate
 Drug Info Approved Acquired prion disease ICD11: 8E01 [3]
Estradiol cypionate
 Drug Info Approved Acquired prion disease ICD11: 8E01 [4]
Estradiol valerate
 Drug Info Approved Acquired prion disease ICD11: 8E01 [4]
Estrone
 Drug Info Approved Menopausal disorder ICD11: GA30 [5]
Nicotine
 Drug Info Approved Nicotine dependence ICD11: 6C4A [6]
Apalutamide
 Drug Info Approved Acute myeloid leukaemia ICD11: 2A60 [7]
Ozanimod
 Drug Info Approved Multiple sclerosis ICD11: 8A40 [8]
Diclofenac sodium
 Drug Info Approved Osteoarthritis ICD11: FA00 [9]
Fospropofol disodium
 Drug Info Approved Monitored anaesthesia care ICD11: N.A. [10]
Montelukast sodium
 Drug Info Approved Asthma ICD11: CA23 [11]
Naloxone
 Drug Info Approved Opiate dependence ICD11: 6C43 [12]
Rosiglitazone
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [13]
Rosiglitazone
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [14]
Rosiglitazone
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [15]
Almogran
 Drug Info Approved Migraine ICD11: 8A80 [16]
Almogran
 Drug Info Approved Migraine ICD11: 8A80 [17]
Imatinib mesylate
 Drug Info Approved Chronic myelogenous leukaemia ICD11: 2A20 [3]
Lidocaine
 Drug Info Approved Anaesthesia ICD11: 8E22 [18]
Brivaracetam
 Drug Info Approved Focal seizure ICD11: 8A68 [19]
Cannabidiol
 Drug Info Approved Lennox-Gastaut syndrome ICD11: 8A62 [20]
Capsaicin
 Drug Info Approved Herpes zoster ICD11: 1E91 [21]
Ethinyl estradiol
 Drug Info Approved Menopausal disorder ICD11: GA30 [22]
Ifosfamide
 Drug Info Approved Lung cancer ICD11: 2C25 [23]
Irbesartan
 Drug Info Approved Essential hypertension ICD11: BA00 [22]
Lapatinib ditosylate
 Drug Info Approved Breast cancer ICD11: 2C60 [24]
Mycophenolate mofetil
 Drug Info Approved Crohn disease ICD11: DD70 [25]
Pitavastatin
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [26]
Pitavastatin
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [27], [28]
Terbinafine hydrochloride
 Drug Info Approved Pityriasis versicolor ICD11: 1F2D [29]
Thiazolidinedione
 Drug Info Approved Alzheimer disease ICD11: 8A20 [30]
Tretinoin
 Drug Info Approved Acne vulgaris ICD11: ED80 [31]
Almotriptan malate
 Drug Info Approved Migraine ICD11: 8A80 [17]
Cabazitaxel
 Drug Info Approved Breast cancer ICD11: 2C60 [32]
Enzalutamide
 Drug Info Approved Prostate cancer ICD11: 2C82 [3]
Enzalutamide
 Drug Info Approved Prostate cancer ICD11: 2C82 [33]
Febuxostat
 Drug Info Approved Hyperuricaemia ICD11: 5C55 [34]
Glasdegib
 Drug Info Approved Acute myeloid leukaemia ICD11: 2A60 [35]
Ixazomib
 Drug Info Approved Amyloidosis ICD11: 5D00 [36]
Pioglitazone hydrochloride
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [37]
Apomorphine
 Drug Info Approved Parkinsonism ICD11: 8A00 [38]
Clomiphene citrate
 Drug Info Approved Female infertility ICD11: GA31 [39]
Ketorolac
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [40]
Nilotinib
 Drug Info Approved Chronic myelogenous leukaemia ICD11: 2A20 [3]
Quinine sulfate
 Drug Info Approved Malaria ICD11: 1F40 [3]
Remdesivir
 Drug Info Approved Coronavirus Disease 2019 (COVID-19) ICD11: 1D6Y [41]
Tepotinib
 Drug Info Approved Lung cancer ICD11: 2C25 [42]
Tepotinib
 Drug Info Approved Lung cancer ICD11: 2C25 [43]
Tucatinib
 Drug Info Approved HER2-positive breast cancer ICD11: 2C60-2C6Y [44]
Tucatinib
 Drug Info Approved HER2-positive breast cancer ICD11: 2C60-2C6Y [45]
Caffeine
 Drug Info Approved Orthostatic hypotension ICD11: BA21 [46]
Cisapride
 Drug Info Approved Gastro-oesophageal reflux disease ICD11: DA22 [47]
Diazepam
 Drug Info Approved Epilepsy ICD11: 8A60 [48]
Diethylstilbestrol
 Drug Info Approved Vaginitis ICD11: GA02 [49]
Ketoprofen
 Drug Info Approved Anaesthesia ICD11: 8E22 [50]
Lansoprazole
 Drug Info Approved Duodenal ulcer ICD11: DA63 [51]
Macitentan
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [52]
Naproxen
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [2]
Repaglinide
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [53]
Rofecoxib
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [3]
Trimethoprim
 Drug Info Approved Infectious cystitis ICD11: GC00 [54]
Verapamil hydrochloride
 Drug Info Approved Essential hypertension ICD11: BA00 [55]
Amitriptyline hydrochloride
 Drug Info Approved Depression ICD11: 6A71 [56]
Brigatinib
 Drug Info Approved Anaplastic large cell lymphoma ICD11: 2A90 [57]
Bromfenac
 Drug Info Approved Cataract ICD11: 9B10 [58]
Captopril
 Drug Info Approved Essential hypertension ICD11: BA00 [59]
Carbamazepine
 Drug Info Approved Epilepsy ICD11: 8A60 [60]
Cyclophosphamide
 Drug Info Approved Multiple myeloma ICD11: 2A83 [23]
Dabrafenib mesylate
 Drug Info Approved Melanoma ICD11: 2C30 [3]
Diltiazem hydrochloride
 Drug Info Approved Essential hypertension ICD11: BA00 [61]
Fluvastatin sodium
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [62]
Ibuprofen
 Drug Info Approved Anaesthesia ICD11: 8E22 [63]
Isotretinoin
 Drug Info Approved Acne vulgaris ICD11: ED80 [64]
Istradefylline
 Drug Info Approved Parkinsonism ICD11: 8A00 [65]
Morphine
 Drug Info Approved Anaesthesia ICD11: 8E22 [66]
Phenytoin
 Drug Info Approved Epilepsy ICD11: 8A60 [18]
Quinidine
 Drug Info Approved Ventricular tachyarrhythmia ICD11: BC71 [3]
Simvastatin
 Drug Info Approved Dyslipidaemia ICD11: 5C81 [67]
Simvastatin
 Drug Info Approved Dyslipidaemia ICD11: 5C81 [68]
Sulfinpyrazone
 Drug Info Approved Uncontrolled gout ICD11: FA25 [18]
Amiodarone hydrochloride
 Drug Info Approved Ventricular tachyarrhythmia ICD11: BC71 [69]
Anastrozole
 Drug Info Approved Breast cancer ICD11: 2C60 [70]
Atorvastatin calcium
 Drug Info Approved Dyslipidaemia ICD11: 5C81 [3]
Azelastine
 Drug Info Approved Allergic rhinitis ICD11: CA08 [71]
Bedaquiline fumarate
 Drug Info Approved Pulmonary tuberculosis ICD11: 1B10 [72], [73]
Buprenorphine hydrochloride
 Drug Info Approved Anaesthesia ICD11: 8E22 [12]
Cabozantinib
 Drug Info Approved Thyroid cancer ICD11: 2D10 [74]
Clozapine
 Drug Info Approved Schizophrenia ICD11: 6A20 [75]
Eszopiclone
 Drug Info Approved Insomnia ICD11: 7A00 [29]
Mirtazapine
 Drug Info Approved Depression ICD11: 6A71 [18]
Omeprazole
 Drug Info Approved Gastro-oesophageal reflux disease ICD11: DA22 [76]
Pazopanib
 Drug Info Approved Renal cell carcinoma ICD11: 2C90 [77]
Perphenazine
 Drug Info Approved Schizophrenia ICD11: 6A20 [78]
Phenprocoumon
 Drug Info Approved Thrombosis ICD11: DB61 [79]
Ponatinib hydrochloride
 Drug Info Approved Acute lymphoblastic leukemia ICD11: 2B33 [80]
Propofol
 Drug Info Approved Anaesthesia ICD11: 8E22 [81]
Sulfamethoxazole
 Drug Info Approved Infectious cystitis ICD11: GC00 [82]
Testosterone undecanoate
 Drug Info Approved Hypogonadism ICD11: 5A61 [3]
Torasemide
 Drug Info Approved Congestive heart failure ICD11: BD10 [83]
Treprostinil
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [84]
Vortioxetine hydrobromide
 Drug Info Approved Depression ICD11: 6A71 [85]
Zafirlukast
 Drug Info Approved Asthma ICD11: CA23 [54]
Apixaban
 Drug Info Approved Deep vein thrombosis ICD11: BD71 [86]
Desloratadine
 Drug Info Approved Allergic rhinitis ICD11: CA08 [87]
Fluorouracilo
 Drug Info Approved Stomach cancer ICD11: 2B72 [88]
Levomethadyl acetate hydrochloride
 Drug Info Approved Opiate dependence ICD11: 6C43 [89]
Levomilnacipran
 Drug Info Approved Depression ICD11: 6A71 [90]
Loperamide hydrochloride
 Drug Info Approved Irritable bowel syndrome ICD11: DD91 [91]
Losartan potassium
 Drug Info Approved Essential hypertension ICD11: BA00 [92]
Lovastatin
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [93]
Methadone
 Drug Info Approved Anaesthesia ICD11: 8E22 [94]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [95], [96]
Mycophenolic acid
 Drug Info Approved Crohn disease ICD11: DD70 [97]
Paclitaxel
 Drug Info Approved Ovarian cancer ICD11: 2C73 [98]
Paclitaxel
 Drug Info Approved Ovarian cancer ICD11: 2C73 [99]
Phenobarbital
 Drug Info Approved Epilepsy ICD11: 8A60 [100]
Piroxicam
 Drug Info Approved Anaesthesia ICD11: 8E22 [101]
Pitavastatin calcium
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [102]
Riociguat
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [103]
Sitagliptin
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [104]
Sorafenib
 Drug Info Approved Renal cell carcinoma ICD11: 2C90 [105]
Sulfadiazine
 Drug Info Approved Toxoplasmosis ICD11: 1F57 [106]
Taxol
 Drug Info Approved Breast cancer ICD11: 2C60-2C6Y [107], [108], [109]
Tazarotene
 Drug Info Approved Psoriasis vulgaris ICD11: EA90 [110]
Timolol maleate
 Drug Info Approved Essential hypertension ICD11: BA00 [111]
Tolbutamide
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [112]
Troglitazone
 Drug Info Approved Diabetes mellitus ICD11: 5A10 [113]
Zidovudine
 Drug Info Approved Human immunodeficiency virus infection ICD11: 1C60 [18]
Azilsartan
 Drug Info Approved Hypertension ICD11: BA00-BA04 [114]
Azilsartan
 Drug Info Approved Hypertension ICD11: BA00-BA04 [115], [116]
Azilsartan medoxomil
 Drug Info Approved Essential hypertension ICD11: BA00 [117]
Celecoxib
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [118]
Cerivastatin sodium
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [3]
Dapsone
 Drug Info Approved Pneumocystis pneumonia ICD11: CA40 [119]
Eltrombopag olamine
 Drug Info Approved Thrombocytopenia ICD11: 3B64 [120]
Flibanserin
 Drug Info Approved Inhibited sexual desire ICD11: HA00 [121]
Lomitapide mesylate
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [122]
Loratadine
 Drug Info Approved Allergic rhinitis ICD11: CA08 [3]
Mefenamic acid
 Drug Info Approved Female pelvic pain ICD11: GA34 [3]
Mephenytoin
 Drug Info Approved Epilepsy ICD11: 8A60 [123]
Nicardipine hydrochloride
 Drug Info Approved Essential hypertension ICD11: BA00 [18]
Pentamidine isethionate
 Drug Info Approved Pneumocystis pneumonia ICD11: CA40 [124]
Selegiline
 Drug Info Approved Major depressive disorder ICD11: 6A70-6A7Z [125]
Selegiline hydrochloride
 Drug Info Approved Parkinsonism ICD11: 8A00 [125]
Selexipag
 Drug Info Approved Pulmonary hypertension ICD11: BB01 [126]
Temazepam
 Drug Info Approved Insomnia ICD11: 7A00 [127]
Benzyl alcohol
 Drug Info Approved Pediculosis ICD11: 1G00 [128]
Chloroquine
 Drug Info Approved Malaria ICD11: 1F40 [129]
Chloroquine
 Drug Info Approved Malaria ICD11: 1F40 [130]
Enasidenib
 Drug Info Approved Acute myeloid leukaemia ICD11: 2A60 [131]
Halofantrine
 Drug Info Approved Malaria ICD11: 1F40 [132]
Lorlatinib
 Drug Info Approved Lung cancer ICD11: 2C25 [133]
Meloxicam
 Drug Info Approved Osteoarthritis ICD11: FA00 [134]
Relugolix
 Drug Info Approved Prostate cancer ICD11: 2C82 [135]
Testosterone cypionate
 Drug Info Approved Testosterone deficiency ICD11: 5A81 [3]
Testosterone enanthate
 Drug Info Approved Testosterone deficiency ICD11: 5A81 [3]
Trimethadione
 Drug Info Approved Epilepsy ICD11: 8A60 [136]
Velpatasvir
 Drug Info Approved Viral hepatitis ICD11: 1E51 [137]
Velpatasvir
 Drug Info Approved Viral hepatitis ICD11: 1E51 [138]
Voxilaprevir
 Drug Info Approved Viral hepatitis ICD11: 1E51 [137]
Voxilaprevir
 Drug Info Approved Viral hepatitis ICD11: 1E51 [139]
Elagolix sodium
 Drug Info Approved Endometriosis ICD11: GA10 [140]
Lovastatin acid
 Drug Info Approved Hypertriglyceridaemia ICD11: 5C80 [141]
Nabilone
 Drug Info Approved Insomnia ICD11: 7A00-7A0Z [142]
Trifarotene
 Drug Info Approved Acne vulgaris ICD11: ED80 [143]
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:        14 Drugs
Ombitasvir
 Drug Info Phase 4 Viral hepatitis ICD11: 1E51 [144]
Mestranol
 Drug Info Phase 4 Menorrhagia ICD11: GA20 [145]
Ketobemidone
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [146]
Amodiaquine
 Drug Info Phase 4 Malaria ICD11: 1F40 [147]
Tienilic acid
 Drug Info Phase 4 Congestive heart failure ICD11: BD10 [29]
Aminophenazone
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [148]
Zopiclone
 Drug Info Phase 4 Insomnia ICD11: 7A00 [149]
Dexibuprofen
 Drug Info Phase 4 Osteoarthritis ICD11: FA00 [63]
Milnacipran
 Drug Info Phase 4 Asperger syndrome ICD11: 6A02 [150]
Milnacipran
 Drug Info Phase 4 Asperger syndrome ICD11: 6A02 [151]
Pranlukast
 Drug Info Phase 4 Obstructive sleep apnea ICD11: 7A41 [152]
Tegafur
 Drug Info Phase 4 Colon cancer ICD11: 2B90 [88]
Beraprost
 Drug Info Phase 4 Influenza virus infection ICD11: 1E30 [153]
Cefaloridine
 Drug Info Phase 4 Staphylococcus infection ICD11: 1B73 [154]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:        36 Drugs
E-3A
 Drug Info Phase 3 Turner syndrome ICD11: LD50 [3]
Selumetinib
 Drug Info Phase 3 Neurofibromatosis ICD11: LD2D [155]
FG-4592
 Drug Info Phase 3 Anaemia ICD11: 3A90 [156]
LY-2484595
 Drug Info Phase 3 Myocardial infarction ICD11: BA41 [157]
Sotorasib
 Drug Info Phase 3 Lung cancer ICD11: 2C25 [59]
BMS-298585
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [158]
Finerenone
 Drug Info Phase 3 Diabetic nephropathy ICD11: GB61 [159], [160], [161]
Finerenone
 Drug Info Phase 3 Diabetic nephropathy ICD11: GB61 [159]
Finerenone
 Drug Info Phase 3 Diabetic nephropathy ICD11: GB61 [161]
Finerenone
 Drug Info Phase 3 Diabetic nephropathy ICD11: GB61 [162]
LAS-17177
 Drug Info Phase 3 Functional nausea/vomiting ICD11: DD90 [163]
ABT-333
 Drug Info Phase 3 Viral hepatitis ICD11: 1E51 [164]
KW-5338
 Drug Info Phase 3 Gastroparesis ICD11: DA41 [165]
LAU-7b
 Drug Info Phase 3 Macular degeneration ICD11: 9B78 [166]
NSC-122758
 Drug Info Phase 3 Vitamin deficiency ICD11: 5B55 [167]
NSC-122758
 Drug Info Phase 3 Vitamin deficiency ICD11: 5B55 [31]
NSC-122758
 Drug Info Phase 3 Vitamin deficiency ICD11: 5B55 [31], [168]
Bexagliflozin
 Drug Info Phase 3 Type-2 diabetes ICD11: 5A11 [169]
CKD-501
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [170]
Masitinib
 Drug Info Phase 3 Amyotrophic lateral sclerosis ICD11: 8B60 [171]
Hydroxychloroquine
 Drug Info Phase 3 Malaria ICD11: 1F40-1F45 [130]
LNP023
 Drug Info Phase 3 IgA nephropathy ICD11: MF8Y [172]
LY-450139
 Drug Info Phase 3 Alzheimer disease ICD11: 8A20 [173]
Imatinib
 Drug Info Phase 3 Mantle cell lymphoma ICD11: 2A85 [3]
TAK-491
 Drug Info Phase 3 Hypertension ICD11: BA00-BA04 [174]
BNP-1350
 Drug Info Phase 3 Ovarian cancer ICD11: 2C73 [175]
MRTX849
 Drug Info Phase 3 Lung cancer ICD11: 2C25 [176]
Ag-221
 Drug Info Phase 3 Acute myelogenous leukaemia ICD11: 2A41 [177]
Atorvastatin
 Drug Info Phase 3 Hypertriglyceridaemia ICD11: 5C80 [62]
CS-011
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [178]
CYT-387
 Drug Info Phase 3 Myelofibrosis ICD11: 2A22 [179]
DRF-2593
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [170]
Elagolix
 Drug Info Phase 3 Uterine leiomyoma ICD11: 2E86 [180]
Montelukast
 Drug Info Phase 3 Asthma ICD11: CA23 [22]
Palovarotene
 Drug Info Phase 3 Fibrodysplasia ossificans progressiva ICD11: FB31 [181]
RG7388
 Drug Info Phase 3 Acute myeloid leukaemia ICD11: 2A60 [182]
      Drugs in Phase 2 Clinical Trial Click to Show/Hide the Full List of Drugs:        26 Drugs
Verapamil
 Drug Info Phase 2/3 Hypertension ICD11: BA00-BA04 [183], [184]
EMD-128130
 Drug Info Phase 2/3 Rett syndrome ICD11: LD90 [185]
QLT-091001
 Drug Info Phase 2/3 Barrett esophagus ICD11: DA23 [167]
Amiodarone
 Drug Info Phase 2/3 Ventricular tachyarrhythmia ICD11: BC71 [186]
PF-06463922
 Drug Info Phase 2 Lung cancer ICD11: 2C25 [187]
BLZ-945
 Drug Info Phase 2 Amyotrophic lateral sclerosis ICD11: 8B60 [188]
GSK-1278863
 Drug Info Phase 2 Asperger syndrome ICD11: 6A02 [189]
LIK-066
 Drug Info Phase 2 Heart failure ICD11: BD10-BD1Z [190]
AZD-2014
 Drug Info Phase 2 Brain cancer ICD11: 2A00 [191]
LJN452
 Drug Info Phase 2 Primary biliary cholangitis ICD11: DB96 [192]
AP26113
 Drug Info Phase 2 Solid tumour/cancer ICD11: 2A00-2F9Z [57]
AP26113
 Drug Info Phase 2 Solid tumour/cancer ICD11: 2A00-2F9Z [193]
AMG 853
 Drug Info Phase 2 Asthma ICD11: CA23 [194]
Ibrolipim
 Drug Info Phase 2 Hypertriglyceridaemia ICD11: 5C80 [195]
AKB-9778
 Drug Info Phase 2 Arterial occlusive disease ICD11: BD4Z [196]
JI-101
 Drug Info Phase 2 Solid tumour/cancer ICD11: 2A00-2F9Z [197]
RDEA3170
 Drug Info Phase 2 Hyperuricaemia ICD11: 5C55 [198]
SAM-531
 Drug Info Phase 2 Alzheimer disease ICD11: 8A20 [199]
VX-680
 Drug Info Phase 2 Solid tumour/cancer ICD11: 2A00-2F9Z [200]
PTC299
 Drug Info Phase 2 Solid tumour/cancer ICD11: 2A00-2F9Z [201]
TAK-063
 Drug Info Phase 2 Schizophrenia ICD11: 6A20 [202]
TAK-906
 Drug Info Phase 2 Gastroparesis ICD11: DA41 [203]
GS-9857
 Drug Info Phase 2 Hepatitis C virus infection ICD11: 1E50-1E51 [204]
KD025
 Drug Info Phase 2 Psoriasis vulgaris ICD11: EA90 [205]
TAK-652
 Drug Info Phase 2 Human immunodeficiency virus infection ICD11: 1C60 [206]
Vidofludimus
 Drug Info Phase 2 Rheumatoid arthritis ICD11: FA20 [207]
      Drugs in Phase 1 Clinical Trial Click to Show/Hide the Full List of Drugs:        10 Drugs
AG-1549
 Drug Info Phase 1 Human immunodeficiency virus infection ICD11: 1C60 [208]
STX 64
 Drug Info Phase 1 Prostate cancer ICD11: 2C82 [209]
MK-0822
 Drug Info Phase 1 Osteoporosis ICD11: FB83 [210]
AST-1306
 Drug Info Phase 1 Solid tumour/cancer ICD11: 2A00-2F9Z [211]
H3B-6545
 Drug Info Phase 1 Breast cancer ICD11: 2C60 [212]
M-813
 Drug Info Phase 1 Schizophrenia ICD11: 6A20 [213]
Alvespimycin hydrochloride
 Drug Info Phase 1 Ovarian cancer ICD11: 2C73 [214]
Benzoylphenylurea
 Drug Info Phase 1 Solid tumour/cancer ICD11: 2A00-2F9Z [215], [216]
AZD-9496
 Drug Info Phase 1 Breast cancer ICD11: 2C60 [217]
ARRY-380
 Drug Info Phase 1 Solid tumour/cancer ICD11: 2A00-2F9Z [218]
      Discontinued/withdrawn Drugs Click to Show/Hide the Full List of Drugs:          8 Drugs
Cilomilast
 Drug Info Discontinued in Phase 3 Emphysema ICD11: CA21 [219]
Darapladib
 Drug Info Discontinued in Phase 3 Arteriosclerosis obliterans ICD11: BD40 [220]
AZD0328
 Drug Info Discontinued in Phase 2 Alzheimer disease ICD11: 8A20 [221]
BMS-181168
 Drug Info Discontinued in Phase 2 Cognitive impairment ICD11: 6D71 [222]
ADD-3878
 Drug Info Discontinued Endometriosis ICD11: GA10 [170]
ML-3000
 Drug Info Discontinued Osteoarthritis ICD11: FA00 [29]
R-1439
 Drug Info Discontinued Diabetes mellitus ICD11: 5A10 [223]
ABT-001
 Drug Info Discontinued Asthma ICD11: CA23 [224]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          6 Drugs
Arachidonic acid
 Drug Info Investigative Discovery agent ICD: N.A. [225]
Antipyrine
 Drug Info Investigative Discovery agent ICD: N.A. [29]
Lauric acid
 Drug Info Investigative Alzheimer disease ICD11: 8A20 [226], [227]
Cyamemazine
 Drug Info Investigative Discovery agent ICD: N.A. [228]
Diclofenac glucuronide
 Drug Info Investigative Discovery agent ICD: N.A. [229]
Paraoxon
 Drug Info Investigative Discovery agent ICD: N.A. [230]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR004533 ABT-001 ABT-001 Metabolite M- Other reaction - Methylhydroxylation ABT-001 [224], [231]
MR012457 AKB-9778 M4 AKB-9778 M5 Conjugation - S-methylation AKB-9778 [196]
MR008995 Almogran N-desmethylalmotriptan Oxidation - N-demethylation Almogran [16]
MR000155 Almotriptan malate LAS 31612 Oxidation - N-Demethylation Almotriptan malate [17], [232]
MR009781 17-DMAG M2 17-DMAG M6 Oxidation - Hydroxylation Alvespimycin hydrochloride [214]
MR011355 AMG 853 AMG 853 Metabolite M2 Unclear - Unclear AMG 853 [194]
MR011356 AMG 853 AMG 853 Metabolite M3 Unclear - Unclear AMG 853 [194]
MR000170 Aminophenazone N-Desmethylaminopyrine Oxidation - N-Dealkylation Aminophenazone [29]
MR000169 Aminophenazone 4-(Dimethylamino)-5-methyl-2-phenyl-1,2-dihydro-3H-pyrazol-3-one Oxidation - N-Dealkylation Aminophenazone [233]
MR010544 Amiodarone Desethylamiodarone Unclear - Unclear Amiodarone [186]
MR013093 Amiodarone hydrochloride Mono-N-desethylamiodarone Oxidation - N-dealkylation Amiodarone hydrochloride [234], [235], [236]
MR002802 Amodiaquine Desethylamodiaquine Oxidation - N-Deethylation Amodiaquine [147]
MR000237 Anastrozole Hydroxyanastrozole Oxidation - Hydroxylation Anastrozole [70]
MR007486 Antipyrine Norantipyrine Unclear - Unclear Antipyrine [29]
MR008510 AP26113 AP26123 Multi-steps Reaction - N-demethylation; cysteine conjugation AP26113 [57]
MR003361 Apalutamide N-desmethyl apalutamide Oxidation - N-Demethylation Apalutamide [237]
MR000248 Apixaban Apixaban M2 metabolite Oxidation - O-Demethylation Apixaban [86], [238]
MR000249 Apixaban Apixaban M4/7 metabolite Oxidation - Hydroxylation Apixaban [86], [238]
MR000256 Apomorphine Norapomorphine Oxidation - N-Demethylation Apomorphine [38]
MR007489 Arachidonic acid EET Unclear - Unclear Arachidonic acid [225]
MR009785 AST-1306 Allitinib M1 Oxidation - O-dealkylation AST-1306 [211]
MR007285 AZD-2014 Unclear Unclear - Unclear AZD-2014 [239]
MR009369 AZD0328 AZD0328 Metabolite M6 Oxidation - N-oxidation AZD0328 [221]
MR008917 Azilsartan Azilsartan M-I Reduction - Decarboxylation Azilsartan [114]
MR013088 Azilsartan Azilsartan M- Oxidation - O-dealkylation Azilsartan medoxomil [117]
MR006029 Bedaquiline fumarate N-desmethyl BDQ (M1) Oxidation - N-demethylation Bedaquiline fumarate [72], [73]
MR011594 Bexagliflozin EGT0001301 Oxidation - Oxidation Bexagliflozin [169]
MR012418 BLZ-945 BLZ-945 M10 Unclear - Unclear BLZ-945 [188]
MR012423 BLZ-945 BLZ-945 M1 Unclear - Unclear BLZ-945 [188]
MR012424 BLZ-945 BLZ-945 M2 Unclear - Unclear BLZ-945 [188]
MR011144 BMS-201038 Lomitapide Metabolite M1 Oxidation - N-dealkylation BMS-201038 [240]
MR000381 BMS-298585 BMS-298585 metabolite M10 Unclear - Unclear BMS-298585 [158], [241]
MR000378 BMS-298585 BMS-298585 metabolite M16 Unclear - Unclear BMS-298585 [158], [241]
MR000376 BMS-298585 BMS-298585 metabolite M1 Oxidation - O-Dealkylation BMS-298585 [158], [241]
MR000379 BMS-298585 BMS-298585 metabolite M15 Unclear - Unclear BMS-298585 [158], [241]
MR000396 BNP-1350 . Unclear - Unclear BNP-1350 [242]
MR000442 Brigatinib AP26123 Oxidation - N-Demethylation; Cysteine Conjugation Brigatinib [57]
MR002552 Brivaracetam Brivaracetam metabolite M1b Oxidation - Hydroxylation Brivaracetam [19]
MR000490 Buprenorphine hydrochloride Norbuprenorphine Oxidation - N-Dealkylation Buprenorphine hydrochloride [66]
MR002575 Cabazitaxel RPR123142 Oxidation - 10-O-Demethylation Cabazitaxel [243]
MR002576 Cabazitaxel RPR112698 Oxidation - 7-O-Demethylation Cabazitaxel [243]
MR002577 Cabazitaxel Cabazitaxel metabolite M1 Oxidation - Hydroxylation Cabazitaxel [243]
MR000538 Cabozantinib EXEL-5162 Oxidation - N-Oxidation Cabozantinib [74]
MR000544 Caffeine 1,3,7-Trimethyluric acid Oxidation - 8-Hydroxylation Caffeine [46], [244]
MR000546 Caffeine Theophylline Oxidation - 7-N-Demethylation Caffeine [46], [244]
MR002818 Capsaicin Capsaicin metabolite M1 Oxidation - Dehydrogenation Capsaicin [21]
MR002819 Capsaicin Capsaicin metabolite M2 Oxidation - Omega-Hydroxylation Capsaicin [21]
MR002820 Capsaicin Capsaicin metabolite M3 Oxidation - Omega-1-Hydroxylation Capsaicin [21]
MR002821 Capsaicin Capsaicin metabolite M4 Oxidation - Dehydrogenation Capsaicin [21]
MR002822 Capsaicin Capsaicin metabolite M5M7 Oxidation - Hydroxylation Capsaicin [21]
MR002823 Capsaicin Capsaicin metabolite M6 Oxidation - O-Dehydrogenation Capsaicin [21]
MR002824 Capsaicin Capsaicin metabolite M8 Oxidation - N-Dehydrogenation; Oxygenation Capsaicin [21]
MR002825 Capsaicin Capsaicin metabolite M9 Oxidation - N-Dehydrogenation Capsaicin [21]
MR002588 Carbamazepine 10,11-Epoxycarbamazepine Oxidation - 10,11-Epoxidation Carbamazepine [245]
MR000587 Celecoxib Hydroxycelecoxib Oxidation - Hydroxylation Celecoxib [246]
MR000602 Cerivastatin sodium Desmethylcerivastatin Oxidation - Demethylation Cerivastatin sodium [247]
MR000601 Cerivastatin sodium Hydroxycerivastatin Oxidation - Hydroxylation Cerivastatin sodium [247]
MR000628 Chloroquine (R)-chloroquine, N-desethyl Oxidation - N-Dealkylation Chloroquine [248], [130], [249]
MR000650 Chlorpropamide 2-OH-chlorpropamide Oxidation - Hydroxylation Chlorpropamide [29]
MR003206 Desisobutyrylciclesonide Ciclesonide metabolite M2 Unclear - Unclear Ciclesonide [250]
MR009433 Cilomilast Cilomilast Metabolite M9 Oxidation - 3-hydroxylation Cilomilast [251], [219]
MR008660 (E)-4-OH-CLOM (E)-4-OH-DE-CLOM Unclear - Unclear Clomiphene citrate [39]
MR008656 Clomiphene citrate (E)-DE-CLOM Unclear - Unclear Clomiphene citrate [39]
MR005317 Cyamemazine N-desmethyl cyamemazine Oxidation - N-demethylation Cyamemazine [252], [228]
MR006601 Desmethyl-dabrafenib M31-Dabrafenib Oxidation - Oxidationn Dabrafenib mesylate [253]
MR000733 Dapsone Dapsone hydroxylamine Oxidation - N-Hydroxylation Dapsone [29]
MR000766 Desloratadine N-glucuronidation 3-hydroxydesloratadine N-glucuronide Oxidation - Hydroxylation Desloratadine [87], [254]
MR004558 Diclofenac glucuronide 4'-Hydroxydiclofenac glucuronide Oxidation - Hydrolyzationn Diclofenac glucuronide [229]
MR002614 Diclofenac sodium 5-hydroxy diclofenac Oxidation - 5-Hydroxylation Diclofenac sodium [255], [256]
MR000906 Eltrombopag olamine Mono-oxygenation Oxidation - Oxidation Eltrombopag olamine [257]
MR006045 EMD-128130 Sarizotan metabolite M364A Oxidation - Hydrolyzationn EMD-128130 [185]
MR006041 EMD-128130 EMD 329989 Oxidation - Hydrolyzationn EMD-128130 [185]
MR006048 EMD-128130 Sarizotan metabolite M364D Oxidation - Monohydroxylation EMD-128130 [185]
MR006867 Enasidenib AGI-16903 Oxidation - N-dealkylation Enasidenib [258]
MR013681 Enzalutamide Enzalutamide metabolite M6 enzalutamide Oxidation - Hydroxylation Enzalutamide [259], [260]
MR013682 Enzalutamide metabolite M6 enzalutamide N-desmethyl enzalutamide Oxidation - Demethylation Enzalutamide [261]
MR013683 N-desmethyl enzalutamide Carboxyl metabolite enzalutamide (M1) Unclear - Unclear Enzalutamide [261], [259]
MR000932 Ertugliflozin Ertugliflozin metabolite M2 Conjugation - Glucuronidation Ertugliflozin [262], [263]
MR002696 Estrone 2-hydroxyestrone Oxidation - Hydroxylation Estrone [264]
MR002706 Estrone 16alpha-OH-estrone Oxidation - Hydroxylation Estrone [265]
MR002707 Estrone 16beta-OH-estrone Oxidation - Hydroxylation Estrone [265]
MR002713 Eszopiclone N-desmethylzopiclone Oxidation - N-Demethylation Eszopiclone [266]
MR002721 Ethinyl estradiol 2-hydroxyethinylestradiol Oxidation - 2-Hydroxylation Ethinyl estradiol [267]
MR002722 Ethinyl estradiol 4-hydroxyethinylestradiol Oxidation - 4-Hydroxylation Ethinyl estradiol [267]
MR002723 Ethinyl estradiol 6-hydroxyethinylestradiol Oxidation - 6-Hydroxylation Ethinyl estradiol [267]
MR002724 Ethinyl estradiol 7-hydroxyethinylestradiol Oxidation - 7-Hydroxylation Ethinyl estradiol [267]
MR002725 Ethinyl estradiol 16alpha-hydroxyethinylestradiol Oxidation - 16-Hydroxylation Ethinyl estradiol [267]
MR003400 Febuxostat Febuxostat metabolite 67M-2 Oxidation - Oxidation Febuxostat [268]
MR012054 FG-4592 FG-4592 Metabolites M1-M3 Oxidation - Hydroxylation FG-4592 [269]
MR005478 Finerenone Finerenone M1 Metabolite Other reaction - Aromatization Finerenone [159], [160], [161]
MR005481 Finerenone Finerenone M4 Metabolite Oxidation - Epoxidation; hydroxylation Finerenone [159], [161]
MR005485 Finerenone Finerenone M14 Metabolite Unclear - Unclear Finerenone [159], [160], [161]
MR005487 Finerenone Finerenone M7 Metabolite Unclear - Unclear Finerenone [159]
MR001063 Fluvastatin sodium 5-hydroxyfluvastatin Oxidation - 5-Hydroxylation Fluvastatin sodium [29], [270]
MR001065 Fluvastatin sodium 5-OH-fluvastatin Oxidation - Hydroxylation Fluvastatin sodium [29], [271], [272]
MR007835 Propofol 4-Hydroxypropofol Unclear - Unclear Fospropofol disodium [10]
MR005071 Halofantrine N-debutylhalofantrine Oxidation - N-debutylation Halofantrine [132]
MR012185 Hydroxychloroquine Monodesethylchloroquine Unclear - Unclear Hydroxychloroquine [273], [130]
MR008501 Ibrolipim Ibrolipim metabolite M-2 Unclear - Unclear Ibrolipim [274], [195]
MR004644 Ibuprofen 2-Hydroxyibuprofen Oxidation - 2-hydroxylation Ibuprofen [29]
MR004641 Ibuprofen 3-Hydroxyibuprofen Oxidation - 3-hydroxylation Ibuprofen [29]
MR004650 Ifosfamide 4-Hydroxyifosfamide Oxidation - 4-hydroxylation Ifosfamide [275]
MR012008 Imatinib Other imatinib metabolites Unclear - Unclear Imatinib [276]
MR004669 Imatinib mesylate N-Desmethylimatinib Oxidation - N-demethylation Imatinib mesylate [29], [277], [278]
MR012487 JI-101 JI-101 M1 Oxidation - Dihydroxylation JI-101 [197]
MR001363 Ketoprofen 2-[3-(4-hydroxybenzoyl) phenyl]-propanoic acid Oxidation - Hydroxylation Ketoprofen [279], [280]
MR001364 Ketoprofen 2-[3-(3-hydroxybenzoyl) phenyl]-propanoic acid Oxidation - Hydroxylation Ketoprofen [279], [280]
MR001365 Ketoprofen 2-[3-(hydroxy(phenyl)methyl) phenyl]-propanoic acid Oxidation - Hydroxylation Ketoprofen [279], [280]
MR001368 Ketorolac 4-hydroxy ketorolac Oxidation - Hydroxylation Ketorolac [281]
MR012461 KLH-2109 KP046 Unclear - Unclear KLH-2109 [282]
MR001427 Lapatinib ditosylate O-dealkylated lapatinib Oxidation - O-Dealkylation Lapatinib ditosylate [283]
MR001428 Lapatinib ditosylate N-dealkylated lapatinib Oxidation - N-Dealkylation Lapatinib ditosylate [283]
MR003708 LAU-7b 4'-hydroxy 4-HPR Unclear - Unclear LAU-7b [166]
MR003704 LAU-7b 4'-oxo 4-HPR Unclear - Unclear LAU-7b [166]
MR005368 Lauric acid 12-Hydroxydodecanoic Acid Oxidation - Aliphatic hydroxylation Lauric acid [226], [227]
MR001505 Levomilnacipran N-desethyl LVM Oxidation - Desmethylation Levomilnacipran [90]
MR012306 LIK-066 LIK-066 M13,14 Oxidation - Oxidation LIK-066 [190]
MR008294 LJN452 LJN452 metabolite M22.4 Oxidation - Oxidation LJN452 [192]
MR011360 LNP023 Metabolite M4 LNP023 Metabolite M3 Oxidation - Oxidation LNP023 [284], [172]
MR006893 Lomitapide mesylate Lomitapide metabolite M1 Other reaction - Cleavage Lomitapide mesylate [122]
MR006894 Lomitapide mesylate Lomitapide metabolite M3 Unclear - Unclear Lomitapide mesylate [122]
MR006895 Loperamide hydrochloride N-demethyl loperamide Oxidation - N-demethylation Loperamide hydrochloride [91]
MR006902 Desloratadine glucuronide 3-Hydroxydesloratadine Oxidation - 3-hydroxylation Loratadine [285]
MR006912 Lorlatinib Lorlatinib benzoic acid metabolite (M8) Oxidation - Oxidationn cleavage Lorlatinib [286]
MR006922 beta-hydroxy acid of lovastatin 6'-beta-Hydroxylovastatin Oxidation - Hydrolyzationn Lovastatin [93]
MR003762 LY-450139 LY-2484595 Metabolite M3 Oxidation - Benzylic hydroxylation LY-450139 [173]
MR013363 M-813 M-813 Metabolite MX1 Unclear - Unclear M-813 [287], [288]
MR013355 M-813 Hydroxyperospirone Oxidation - Hydrolyzationn M-813 [213], [288]
MR013365 M-813 ID-11614 Unclear - Unclear M-813 [288]
MR013366 M-813 ID-15010 Unclear - Unclear M-813 [288]
MR006937 Macitentan Aprocitentan Oxidation - Depropylation Macitentan [52]
MR006942 Macitentan Macitentan metabolite M7 Oxidation - Hydrolyzationn Macitentan [52]
MR011998 Masitinib N-desmethyl masitinib(M485) Unclear - Unclear Masitinib [171]
MR012001 MCN524 MCN526 Unclear - Unclear Masitinib [289]
MR012001 MCN524 MCN526 Unclear - Unclear Masitinib [290]
MR012000 Minium ion intermediate MCN524 Unclear - Unclear Masitinib [291]
MR012000 Minium ion intermediate MCN524 Unclear - Unclear Masitinib [292]
MR012003 Reactive iminium ion MCN510 Unclear - Unclear Masitinib [293]
MR001631 Mefenamic acid Mefenamic acyl-beta-D-glucuronide Conjugation - N-Glucuronidation Mefenamic acid [3]
MR002857 Meloxicam 5-hydroxymethyl meloxicam Oxidation - Hydroxylation Meloxicam [294], [295]
MR001645 17alpha-Ethinylestradiol 2-hydroxyethinylestradiol Oxidation - 2-Hydroxylation Mestranol [296], [297]
MR001646 17alpha-Ethinylestradiol 4-hydroxyethinylestradiol Oxidation - 4-Hydroxylation Mestranol [296], [297]
MR001647 17alpha-Ethinylestradiol 6-hydroxyethinylestradiol Oxidation - 6-Hydroxylation Mestranol [296], [297]
MR001648 17alpha-Ethinylestradiol 7-hydroxyethinylestradiol Oxidation - 7-Hydroxylation Mestranol [296], [297]
MR001649 17alpha-Ethinylestradiol 16alpha-hydroxyethinylestradiol Oxidation - 16-Hydroxylation Mestranol [296], [297]
MR001657 4-formyl-amino-antipyrine (FAA) 4-amino-antipyrine (AA) Oxidation - N-Demethylation Metamizole sodium [298], [299]
MR001655 N-Desmethylaminopyrine 4-amino-antipyrine (AA) Oxidation - N-Demethylation Metamizole sodium [298], [299]
MR009998 Methadone EDDP Oxidation - N-demethylation Methadone [94], [300]
MR001685 Milnacipran N-Desethyl milnacipran Oxidation - Desethylation Milnacipran [150]
MR003953 MK-0822 MK-0822 Metabolite M8 (Odanacatib) Oxidation - Hydrolyzationn MK-0822 [210]
MR007633 Licofelone acyl glucuronide (M1) Licofelone M3 Oxidation - Hydrolyzationn ML-3000 [29]
MR007630 ML-3000 Licofelone M4 Oxidation - Hydrolyzationn ML-3000 [29]
MR007634 ML-3000 Licofelone M2 Oxidation - Hydrolyzationn ML-3000 [29]
MR004797 Montelukast 1, 2-Diol Montelukast dicarboxylic acid Unclear - Unclear Montelukast sodium [301]
MR004802 Montelukast sodium 25-OH Montelukast Unclear - Unclear Montelukast sodium [301]
MR005404 MRTX849 Unclear Unclear - Unclear MRTX849 [302]
MR004812 Mycophenolic acid 6-O-desmethyl-MPA (DM-MPA) Unclear - Unclear Mycophenolate mofetil [303]
MR004823 Mycophenolic acid 6-O-desmethyl-mycophenolic acid Oxidation - Demethylation Mycophenolic acid [95], [96]
MR003382 R-Naftopidil R-Naftopidil metabolite M1 Unclear - Unclear Naftopidil [304], [305]
MR003383 R-Naftopidil R-Naftopidil metabolite M2 Unclear - Unclear Naftopidil [304], [305]
MR003384 R-Naftopidil R-Naftopidil metabolite M3 Unclear - Unclear Naftopidil [304], [305]
MR003385 S-Naftopidil R-Naftopidil metabolite M1 Unclear - Unclear Naftopidil [304], [305]
MR003386 S-Naftopidil R-Naftopidil metabolite M2 Unclear - Unclear Naftopidil [304], [305]
MR004871 Naproxen O-Desmethylnaproxen Oxidation - O-demethylation Naproxen [29], [2], [306], [307]
MR001730 Nicardipine hydrochloride Dehydronicardipine Oxidation - Heteroring Dehydrogenation Nicardipine hydrochloride [233], [18], [308]
MR001729 Nicardipine hydrochloride De-benzylated nicardipine Oxidation - N-Dealkylation Nicardipine hydrochloride [233], [18]
MR003547 Nintedanib esylate Nintedanib metabolite M13 Unclear - Unclear Nintedanib esylate [309]
MR003546 Nintedanib esylate Nintedanib metabolite M8 Oxidation - Hydroxylation Nintedanib esylate [309]
MR006380 NSC-122758 4-Hydroxyretinoic acid Oxidation - 4-hydroxylation NSC-122758 [31]
MR006381 NSC-122758 All-trans-18-Hydroxyretinoic acid Oxidation - Hydrolyzationn NSC-122758 [31], [168]
MR006382 NSC-122758 5,6-Epoxyretinoic acid Unclear - Unclear NSC-122758 [31]
MR001818 Olodaterol hydrochloride O-demethylated olodaterol Oxidation - O-Demethylation Olodaterol hydrochloride [310]
MR014143 Ombitasvir Metabolite M23 Ombitasvir Metabolite M26 Oxidation - Oxidation Ombitasvir [144]
MR014144 Ombitasvir Metabolite M26 Ombitasvir Metabolite M25 Oxidation - Oxidation Ombitasvir [144]
MR014145 Ombitasvir Metabolite M26 Ombitasvir Metabolite M37 Multi-steps Reaction - Oxidation; C-demethylation Ombitasvir [144]
MR014146 Ombitasvir Metabolite M26 Ombitasvir Metabolite M36 Multi-steps Reaction - Oxidation; C-demethylation Ombitasvir [144]
MR014147 Ombitasvir Metabolite M26 Ombitasvir Metabolite M29 Multi-steps Reaction - Oxidation; C-demethylation Ombitasvir [144]
MR014148 Ombitasvir Metabolite M26 Ombitasvir Metabolite M35 Multi-steps Reaction - Oxidation; C-demethylation Ombitasvir [144]
MR014149 Ombitasvir Metabolite M26 Ombitasvir Metabolite M34 Multi-steps Reaction - Oxidation; C-demethylation Ombitasvir [144]
MR014150 Ombitasvir Metabolite M26 Ombitasvir Metabolite M28 Multi-steps Reaction - Oxidation; C-demethylation Ombitasvir [144]
MR005568 CC112273 CC1084037 Unclear - Unclear Ozanimod [8]
MR005568 CC112273 CC1084037 Unclear - Unclear Ozanimod [8]
MR014020 CC112273 CC1084037 Unclear Ozanimod [8]
MR005570 RP101442 RP101509 Unclear - Unclear Ozanimod [311]
MR005571 RP101442 RP112509 Unclear - Unclear Ozanimod [311]
MR005570 RP101442 RP101509 Unclear - Unclear Ozanimod [311]
MR005571 RP101442 RP112509 Unclear - Unclear Ozanimod [311]
MR014022 RP101442 RP101509 Unclear Ozanimod [311]
MR014023 RP101442 RP112509 Unclear Ozanimod [311]
MR001909 Paclitaxel 6alpha-hydroxypaclitaxel Oxidation - Hydroxylation Paclitaxel [312]
MR001948 Pazopanib Pazopanib hydrochloride Oxidation - Hydroxylation; N-Demethylation Pazopanib [313], [77], [314]
MR002005 Perphenazine N-Dealkylated perphenazine Oxidation - N-Dealkylation Perphenazine [315]
MR011750 PF-06463922 PF-06895751 (M8) Unclear - Unclear PF-06463922 [187]
MR002023 Phenobarbital 4-hydroxyphenobarbital Oxidation - 4-Hydroxylation Phenobarbital [29]
MR002024 Phenobarbital Mephobarbital Conjugation - Methylation Phenobarbital [316]
MR002025 Phenprocoumon 4'-hydroxy-R-phenprocoumon Oxidation - 4'-Hydroxylation Phenprocoumon [29]
MR002036 Phenytoin Phenytoin dihydrodiol Oxidation - Dihydroxylation; Oxidation Phenytoin [29]
MR002051 Pioglitazone hydrochloride Pioglitazone metabolite M-II Oxidation - Oxidation Pioglitazone hydrochloride [54], [317]
MR002052 Pioglitazone hydrochloride Pioglitazone metabolite M-VI Oxidation - Oxidation Pioglitazone hydrochloride [54]
MR002053 Pioglitazone hydrochloride Pioglitazone metabolite M-V Oxidation - Oxidation Pioglitazone hydrochloride [54], [317]
MR002054 Pioglitazone hydrochloride Pioglitazone metabolite M-IV Oxidation - Oxidation Pioglitazone hydrochloride [54], [317]
MR002045 Pioglitazone metabolite M-II Pioglitazone metabolite M-XI Oxidation - Oxidation Pioglitazone hydrochloride [54], [317]
MR002048 Pioglitazone metabolite M-IV Pioglitazone metabolite M-XI Oxidation - Oxidation Pioglitazone hydrochloride [54], [317]
MR008868 Pitavastatin Pitavastatin metabolite M-13 Oxidation - Oxidation Pitavastatin [28]
MR002068 Pitavastatin M-13 Oxidation - Oxidation Pitavastatin calcium [318]
MR002083 Ponatinib hydrochloride AP24567 Oxidation - N-Demethylation Ponatinib hydrochloride [319], [320], [321]
MR005182 Pranlukast Pranlukast M-1 Oxidation - Hydrolyzationn Pranlukast [152]
MR005184 Pranlukast Pranlukast HM-1 Oxidation - Hydrolyzationn Pranlukast [152]
MR012497 PTC299 O-Desmethyl emvododstat Unclear - Unclear PTC299 [201]
MR006063 QLT-091001 4-Hydroxyretinol Oxidation - Hydrolyzationn QLT-091001 [167]
MR006064 QLT-091001 3-Hydroxyretinol Oxidation - Hydrolyzationn QLT-091001 [167]
MR005585 Relugolix Unclear Unclear - Unclear Relugolix [135]
MR013218 Remdesivir Remdesivir M1 Unclear - Unclear Remdesivir [41]
MR013049 Repaglinide Repaglinide M2 Unclear - Unclear Repaglinide [322], [323]
MR013051 Repaglinide Hydroxyrepaglinide Oxidation - Hydroxylation Repaglinide [322]
MR013052 Repaglinide Repaglinide M1 Oxidation - Oxidation Repaglinide [322], [323]
MR013053 Repaglinide Repaglinide M5 Unclear - Unclear Repaglinide [324]
MR013055 Repaglinide Repaglinide M0-OH Oxidation - Hydroxylation Repaglinide [324]
MR009576 Rosiglitazone N-Desmethylrosiglitazone Oxidation - N-demethylation Rosiglitazone [29]
MR009582 Rosiglitazone Para-Hydroxyrosiglitazone Oxidation - Hydroxylation Rosiglitazone [29]
MR009586 Rosiglitazone Ortho-Hydroxyrosiglitazone Oxidation - Hydroxylation Rosiglitazone [29]
MR009576 Rosiglitazone N-desmethyl?rosiglitazone Oxidation - N-demethylation Rosiglitazone [325]
MR009582 Rosiglitazone p-hydroxy?rosiglitazone Oxidation - Hydroxylation Rosiglitazone [325]
MR009592 Rosuvastatin N-Desmethylrosuvastatin Oxidation - N-demethylation Rosuvastatin [29], [326]
MR009593 Rosuvastatin Rosuvastatin 5S-lactone Oxidation - N-dealkylation Rosuvastatin [29], [326]
MR008515 SAM-531 Desmethylcerlapirdine Oxidation - Demethylation SAM-531 [199]
MR002237 ACT-333679 Hydroxylated and dealkylated products Oxidation - Oxidation Selexipag [327]
MR005261 Silymarin O-demethylated-silybin Oxidation - O-dealkylation Silymarin [328], [329]
MR013434 Simvastatin 6'-beta-Hydroxysimvastatin Oxidation - Aliphatic hydroxylation Simvastatin [233]
MR013433 Simvastatin Simvastatin hydroxy acid Oxidation - 3'-hydroxylation Simvastatin [330]
MR006817 Sitagliptin Sitagliptin M6 Metabolite Oxidation - Carbamoylation Sitagliptin [331]
MR006819 Sitagliptin Sitagliptin M1 Metabolite Conjugation - Sulfation Sitagliptin [331]
MR006820 Sitagliptin Sitagliptin M2 and M5 Metabolites Other reaction - Cyclization Sitagliptin [331]
MR006834 Sorafenib Pyridine N-oxide glucuronide Multi-steps Reaction - Oxidationn; glucuronidation Sorafenib [95], [105]
MR006833 Sorafenib Pyridostigmine Oxidation - Oxidationn Sorafenib [95]
MR013546 Sotorasib Sotorasib Metabolite M18 Oxidation - Oxidation Sotorasib [332], [59]
MR008425 STX 64 STX 64 metabolite M13 Oxidation - Hydroxylation STX 64 [209]
MR008443 STX 64 STX 64 metabolite M9 Oxidation - Hydroxylation STX 64 [209]
MR006846 Sulfadiazine Sulfadiazine hydroxylamine Multi-steps Reaction - Hydrolyzationn; sulfadiazine acetylation Sulfadiazine [333]
MR002280 Sulfamethoxazole Sulfamethoxazole N4-hydroxylamine Oxidation - N-Hydroxylation Sulfamethoxazole [29], [82], [334]
MR012520 TAK-063 TAK-063 MI Unclear - Unclear TAK-063 [202]
MR011373 Azilsartan TAK-491 Metabolite M1 Reduction - Decarboxylation TAK-491 [114]
MR010218 Taxol 6alpha-hydroxypaclitaxel?(6alpha-OHP) Unclear - Unclear Taxol [109]
MR011040 Taxol 6alpha-hydroxypaclitaxel Unclear - Unclear Taxol [109]
MR002343 Tazarotenic acid AGN 190844 Oxidation - Oxidation Tazarotene [335], [110], [336]
MR005270 5'-hydroxytegafur Fluorouracil Other reaction - Degradation Tegafur [18], [88]
MR002376 O-conjugate of temazepam Temazepam metabolite M1 Oxidation - Demethylation Temazepam [337], [127]
MR002378 Temazepam Oxazepam Oxidation - Demethylation Temazepam [338], [337]
MR002385 Temsirolimus 27-O-desmethyl temsirolimus Oxidation - O-Demethylation Temsirolimus [339]
MR002386 Temsirolimus 25-hydroxy temsirolimus Oxidation - Hydroxylation Temsirolimus [339]
MR002387 Temsirolimus Hydroxy-piperidine temsirolimus Oxidation - Hydroxylation Temsirolimus [339]
MR005628 Tepotinib Tepotinib M506 metabolite Oxidation - Oxidationn Tepotinib [42]
MR002399 Hydroxyterbinafine N-Desmethylhydroxyterbinafine Oxidation - N-Demethylation Terbinafine hydrochloride [340], [341]
MR002400 Hydroxyterbinafine Carboxyterbinafine Oxidation - Oxidation Terbinafine hydrochloride [340]
MR002401 N-Desmethylterbinafine N-Desmethylhydroxyterbinafine Oxidation - Hydoxylation Terbinafine hydrochloride [340]
MR002406 Terbinafine dihydrodiol derivative (1) N-Desmethylterbinafine dihydrodiol derivative (1) Oxidation - N-Demethylation Terbinafine hydrochloride [340]
MR002407 Terbinafine dihydrodiol derivative (2) N-Desmethylterbinafine dihydrodiol derivative (2) Oxidation - N-Demethylation Terbinafine hydrochloride [340]
MR002409 Terbinafine hydrochloride N-Desmethylterbinafine Oxidation - N-Demethylation Terbinafine hydrochloride [340]
MR002410 Terbinafine hydrochloride 1-Naphthaldehyde Oxidation - Deamination Terbinafine hydrochloride [340]
MR002408 Terbinafine hydrochloride Hydroxyterbinafine Oxidation - Hydoxylation Terbinafine hydrochloride [340]
MR006192 Tienilic acid Thiophene-4,5-epoxide Oxidation - Epoxidation Tienilic acid [29]
MR006190 Tienilic acid Ticrynafen S-oxide Oxidation - Oxidationn Tienilic acid [29]
MR006191 Tienilic acid Tienilic acid-s-oxide Oxidation - S-oxidation Tienilic acid [29]
MR004995 M1 metabolite, timolol Timolol maleate Metabolite M4 Unclear - Unclear Timolol maleate [111]
MR004997 Timolol maleate Timolol maleate Metabolite M2 Unclear - Unclear Timolol maleate [111]
MR006800 Torasemide Torasemide metabolite M1 (hydroxytorsemide) Oxidation - Hydrolyzationn Torasemide [342]
MR006802 Torasemide Torasemide metabolite M4 Oxidation - Hydrolyzationn Torasemide [342]
MR006803 Torasemide Torasemide metabolite M2 Reduction - Reduction Torasemide [342]
MR006804 Torasemide Torasemide metabolite M3 Oxidation - Hydrolyzationn Torasemide [342]
MR009627 4-Hydroxyretinoic acid 4-Oxoretinoic acid Oxidation - Oxidation Tretinoin [31], [343]
MR009636 Tretinoin 18-OH-RA Oxidation - Hydroxylation Tretinoin [31], [343], [64]
MR009626 Tretinoin 4-Hydroxyretinoic acid Oxidation - 4-hydroxylation Tretinoin [31], [64]
MR009629 Tretinoin 5,6-epoxy-RA Oxidation - Ring epoxidation Tretinoin [343], [343], [31]
MR009631 Tretinoin 13-cis RA Other reaction - Isomerization Tretinoin [64], [343]
MR009634 Tretinoin 9-cis RA Other reaction - Isomerization Tretinoin [64], [343]
MR002452 Trifarotene . Unclear - Unclear Trifarotene [344]
MR002466 Troglitazone Troglitazone Quinone Oxidation - Oxidation Troglitazone [345], [346]
MR008168 Tucatinib Tucatinib metabolite M1 Oxidation - Hydroxylation Tucatinib [45]
MR002505 Velpatasvir Desmethyl-velpatasvir Oxidation - O-Demethylation Velpatasvir [347]
MR010524 Norverapamil D-715 (PR-22) Unclear - Unclear Verapamil [29]
MR010525 Norverapamil D-620 Unclear - Unclear Verapamil [29]
MR010529 Verapamil D-702 Unclear - Unclear Verapamil [29]
MR010523 Verapamil Norverapamil Unclear - Unclear Verapamil [29]
MR010531 Verapamil N19 (D-703) Unclear - Unclear Verapamil [29]
MR010526 Verapamil D-617 Unclear - Unclear Verapamil [29]
MR005648 Norverapamil Verapamil metabolite D-620 Oxidation - N-dealkylation Verapamil hydrochloride [29]
MR005649 Norverapamil Verapamil metabolite D-715 Oxidation - O-demethylation Verapamil hydrochloride [29]
MR005650 Verapamil hydrochloride O-Desmethylverapamil (D-702) Oxidation - O-demethylation Verapamil hydrochloride [29]
MR005652 Verapamil hydrochloride O-Desmethylverapamil (D-703) Oxidation - O-demethylation Verapamil hydrochloride [29]
MR005674 Vortioxetine hydrobromide Vortioxetine Metabolite 4a Oxidation - Oxidationn Vortioxetine hydrobromide [85], [348]
MR010389 VX-680 VRT-171335 Oxidation - N-desmethylation VX-680 [200]
MR013261 Warfarin sodium R-4'-Hydroxywarfarin Oxidation - 4'-hydroxylation Warfarin sodium [349], [350]
MR013258 Warfarin sodium R-7-Hydroxywarfarin Oxidation - 7-hydroxylation Warfarin sodium [349], [350]
MR005676 Zidovudine 3'-Aminothymidine Reduction - Reduction Zidovudine [18], [351]
MR009649 Zopiclone Zopiclone N-oxide Oxidation - N-oxidation Zopiclone [29], [352]
MR009651 Zopiclone N-desmethylzopiclone Oxidation - N-demethylation Zopiclone [29], [352]
⏷ Show the Full List of 296 MR(s)
Tissue/Disease-Specific Protein Abundances of This DME
      Tissue-specific Protein Abundances in Healthy Individuals Click to Show/Hide
Download the Tissue-Specific Variation(s) Profile
      ICD Disease Classification 01 Infectious/parasitic disease Click to Show/Hide
                  ICD-11: 1C1H     Necrotising ulcerative gingivitis Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.65E-02; Fold-change: -4.48E-02; Z-score: -3.36E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 1E30     Influenza Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.60E-01; Fold-change: 6.49E-02; Z-score: 5.99E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 1E51     Chronic viral hepatitis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.25E-01; Fold-change: -7.20E-02; Z-score: -3.91E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 1G41     Sepsis with septic shock Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.18E-03; Fold-change: 3.05E-02; Z-score: 2.48E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CA40     Respiratory syncytial virus infection Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.81E-01; Fold-change: -2.18E-02; Z-score: -1.84E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CA42     Rhinovirus infection Click to Show/Hide
The Studied Tissue     Nasal epithelium tissue
The Specified Disease     Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.43E-01; Fold-change: -6.22E-02; Z-score: -3.13E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: KA60     Neonatal sepsis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.36E-02; Fold-change: -1.84E-02; Z-score: -1.77E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 02 Neoplasm Click to Show/Hide
                  ICD-11: 2A00     Brain cancer Click to Show/Hide
The Studied Tissue     Nervous tissue
The Specified Disease     Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.91E-19; Fold-change: -2.17E-01; Z-score: -5.99E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Brain stem tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.52E-01; Fold-change: -3.60E-01; Z-score: -6.10E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     White matter tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.60E-01; Fold-change: -3.65E-02; Z-score: -2.54E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Brain stem tissue
The Specified Disease     Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.68E-01; Fold-change: -1.36E-01; Z-score: -8.23E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2A20     Myeloproliferative neoplasm Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.34E-04; Fold-change: 1.21E-01; Z-score: 1.86E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Whole blood
The Specified Disease     Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.82E-10; Fold-change: 8.78E-02; Z-score: 1.41E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2A36     Myelodysplastic syndrome Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.53E-02; Fold-change: 6.59E-02; Z-score: 3.19E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 3.59E-06; Fold-change: 2.91E-01; Z-score: 5.64E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2A81     Diffuse large B-cell lymphoma Click to Show/Hide
The Studied Tissue     Tonsil tissue
The Specified Disease     Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.40E-02; Fold-change: 1.71E-01; Z-score: 1.15E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2A83     Plasma cell neoplasm Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.83E-01; Fold-change: 2.87E-03; Z-score: 6.52E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Bone marrow
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.86E-02; Fold-change: -1.69E-01; Z-score: -8.79E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2B33     Leukaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.69E-07; Fold-change: 4.42E-03; Z-score: 4.31E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2B6E     Oral cancer Click to Show/Hide
The Studied Tissue     Oral tissue
The Specified Disease     Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.73E-01; Fold-change: -6.13E-02; Z-score: -3.28E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.74E-02; Fold-change: -8.48E-02; Z-score: -4.78E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2B70     Esophageal cancer Click to Show/Hide
The Studied Tissue     Esophagus
The Specified Disease     Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 6.83E-03; Fold-change: 1.17E-01; Z-score: 1.21E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
                  ICD-11: 2B72     Stomach cancer Click to Show/Hide
The Studied Tissue     Gastric tissue
The Specified Disease     Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.23E-01; Fold-change: -1.33E+00; Z-score: -1.24E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.43E-03; Fold-change: -7.19E-01; Z-score: -8.16E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2B90     Colon cancer Click to Show/Hide
The Studied Tissue     Colon tissue
The Specified Disease     Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.66E-04; Fold-change: -1.21E-01; Z-score: -5.72E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.45E-07; Fold-change: -1.57E-01; Z-score: -5.24E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2B92     Rectal cancer Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.51E-01; Fold-change: -1.41E-01; Z-score: -8.46E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.66E-01; Fold-change: -8.50E-02; Z-score: -8.23E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C10     Pancreatic cancer Click to Show/Hide
The Studied Tissue     Pancreas
The Specified Disease     Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.25E-02; Fold-change: -6.67E-01; Z-score: -6.53E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 9.33E-01; Fold-change: -1.58E-01; Z-score: -3.31E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C12     Liver cancer Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.82E-30; Fold-change: -1.89E+00; Z-score: -2.75E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.74E-83; Fold-change: -1.59E+00; Z-score: -4.32E+00
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 7.56E-05; Fold-change: -1.92E+00; Z-score: -5.89E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
Download DME expression data in the tissue of the other disease section
                  ICD-11: 2C25     Lung cancer Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.28E-05; Fold-change: 1.90E-02; Z-score: 1.09E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.24E-01; Fold-change: -5.46E-02; Z-score: -2.97E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C30     Skin cancer Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.32E-01; Fold-change: -3.32E-02; Z-score: -1.47E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Skin
The Specified Disease     Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.07E-10; Fold-change: 1.05E-01; Z-score: 5.98E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.67E-03; Fold-change: 1.92E-02; Z-score: 8.28E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C6Z     Breast cancer Click to Show/Hide
The Studied Tissue     Breast tissue
The Specified Disease     Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.08E-07; Fold-change: -1.25E-02; Z-score: -6.37E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 9.76E-01; Fold-change: -5.07E-02; Z-score: -1.54E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C73     Ovarian cancer Click to Show/Hide
The Studied Tissue     Ovarian tissue
The Specified Disease     Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.13E-01; Fold-change: 6.17E-02; Z-score: 2.28E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 6.12E-01; Fold-change: -4.38E-02; Z-score: -6.03E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C77     Cervical cancer Click to Show/Hide
The Studied Tissue     Cervical tissue
The Specified Disease     Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.86E-01; Fold-change: -5.49E-02; Z-score: -2.79E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C78     Uterine cancer Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.03E-01; Fold-change: -6.96E-02; Z-score: -3.05E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.90E-03; Fold-change: 1.77E-01; Z-score: 1.49E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C82     Prostate cancer Click to Show/Hide
The Studied Tissue     Prostate
The Specified Disease     Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.27E-01; Fold-change: -1.74E-02; Z-score: -6.97E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C90     Renal cancer Click to Show/Hide
The Studied Tissue     Kidney
The Specified Disease     Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.73E-04; Fold-change: 1.53E-01; Z-score: 7.44E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.82E-01; Fold-change: -7.17E-03; Z-score: -1.58E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C92     Ureter cancer Click to Show/Hide
The Studied Tissue     Urothelium
The Specified Disease     Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.65E-01; Fold-change: 2.72E-02; Z-score: 2.78E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2C94     Bladder cancer Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.15E-03; Fold-change: 1.83E-01; Z-score: 9.23E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2D02     Retinal cancer Click to Show/Hide
The Studied Tissue     Uvea
The Specified Disease     Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.09E-09; Fold-change: -1.53E+00; Z-score: -4.40E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2D10     Thyroid cancer Click to Show/Hide
The Studied Tissue     Thyroid
The Specified Disease     Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.39E-01; Fold-change: -5.46E-02; Z-score: -2.77E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.07E-01; Fold-change: -4.30E-02; Z-score: -2.18E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2D11     Adrenal cancer Click to Show/Hide
The Studied Tissue     Adrenal cortex
The Specified Disease     Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 5.93E-01; Fold-change: -1.06E-02; Z-score: -2.70E-02
DME expression in the diseased tissue of patients
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of the other disease section
                  ICD-11: 2D12     Endocrine gland neoplasm Click to Show/Hide
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.90E-01; Fold-change: -1.23E-01; Z-score: -4.33E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.39E-01; Fold-change: 4.85E-01; Z-score: 1.63E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 2D42     Head and neck cancer Click to Show/Hide
The Studied Tissue     Head and neck tissue
The Specified Disease     Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.90E-11; Fold-change: -1.06E-01; Z-score: -1.42E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 03 Blood/blood-forming organ disease Click to Show/Hide
                  ICD-11: 3A51     Sickle cell disorder Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.71E-02; Fold-change: 1.03E-01; Z-score: 7.57E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 3A70     Aplastic anaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.03E-01; Fold-change: 7.61E-02; Z-score: 6.10E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 3B63     Thrombocytosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.60E-03; Fold-change: 6.33E-02; Z-score: 9.75E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 3B64     Thrombocytopenia Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.83E-01; Fold-change: 3.92E-02; Z-score: 2.84E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 04 Immune system disease Click to Show/Hide
                  ICD-11: 4A00     Immunodeficiency Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.03E-01; Fold-change: 6.81E-03; Z-score: 7.23E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 4A40     Lupus erythematosus Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.14E-01; Fold-change: -4.97E-02; Z-score: -1.73E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 4A42     Systemic sclerosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.56E-01; Fold-change: 7.80E-03; Z-score: 9.30E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 4A43     Systemic autoimmune disease Click to Show/Hide
The Studied Tissue     Salivary gland tissue
The Specified Disease     Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.93E-01; Fold-change: 4.14E-02; Z-score: 2.77E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.67E-01; Fold-change: -7.56E-02; Z-score: -1.10E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: 4A62     Behcet disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.73E-01; Fold-change: 4.16E-02; Z-score: 2.75E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 4B04     Monocyte count disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.46E-01; Fold-change: 2.44E-02; Z-score: 2.39E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 05 Endocrine/nutritional/metabolic disease Click to Show/Hide
                  ICD-11: 5A11     Type 2 diabetes mellitus Click to Show/Hide
The Studied Tissue     Omental adipose tissue
The Specified Disease     Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.09E-01; Fold-change: 4.31E-02; Z-score: 5.74E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Liver tissue
The Specified Disease     Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.79E-01; Fold-change: -1.88E-02; Z-score: -1.73E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 5A80     Ovarian dysfunction Click to Show/Hide
The Studied Tissue     Vastus lateralis muscle
The Specified Disease     Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.04E-01; Fold-change: -4.02E-03; Z-score: -2.88E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 5C51     Inborn carbohydrate metabolism disorder Click to Show/Hide
The Studied Tissue     Biceps muscle
The Specified Disease     Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.45E-03; Fold-change: -9.40E-02; Z-score: -1.00E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 5C56     Lysosomal disease Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.38E-01; Fold-change: 1.89E-02; Z-score: 1.52E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 5C80     Hyperlipoproteinaemia Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.28E-01; Fold-change: 1.37E-02; Z-score: 1.60E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Whole blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.47E-02; Fold-change: -1.13E-01; Z-score: -1.13E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 06 Mental/behavioural/neurodevelopmental disorder Click to Show/Hide
                  ICD-11: 6A02     Autism spectrum disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.53E-01; Fold-change: -3.07E-02; Z-score: -2.20E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 6A20     Schizophrenia Click to Show/Hide
The Studied Tissue     Prefrontal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.94E-01; Fold-change: -1.03E-01; Z-score: -3.08E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Superior temporal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.37E-02; Fold-change: 9.49E-02; Z-score: 8.07E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 6A60     Bipolar disorder Click to Show/Hide
The Studied Tissue     Prefrontal cortex
The Specified Disease     Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.07E-01; Fold-change: 3.97E-02; Z-score: 1.59E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 6A70     Depressive disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.38E-01; Fold-change: -3.36E-04; Z-score: -2.09E-03
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Hippocampus
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.17E-01; Fold-change: -6.95E-02; Z-score: -2.88E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 08 Nervous system disease Click to Show/Hide
                  ICD-11: 8A00     Parkinsonism Click to Show/Hide
The Studied Tissue     Substantia nigra tissue
The Specified Disease     Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.57E-01; Fold-change: -7.89E-02; Z-score: -7.93E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8A01     Choreiform disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.93E-01; Fold-change: 3.65E-03; Z-score: 3.43E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8A20     Alzheimer disease Click to Show/Hide
The Studied Tissue     Entorhinal cortex
The Specified Disease     Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.82E-04; Fold-change: -1.35E-01; Z-score: -5.84E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8A2Y     Neurocognitive impairment Click to Show/Hide
The Studied Tissue     White matter tissue
The Specified Disease     HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.78E-01; Fold-change: 9.78E-03; Z-score: 5.42E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8A40     Multiple sclerosis Click to Show/Hide
The Studied Tissue     Plasmacytoid dendritic cells
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.78E-01; Fold-change: -3.38E-03; Z-score: -5.71E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Spinal cord
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.62E-01; Fold-change: 6.09E-03; Z-score: 2.36E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
                  ICD-11: 8A60     Epilepsy Click to Show/Hide
The Studied Tissue     Peritumoral cortex tissue
The Specified Disease     Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 1.39E-01; Fold-change: 2.09E-01; Z-score: 1.02E+00
DME expression in the diseased tissue of patients
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of the other disease section
The Studied Tissue     Whole blood
The Specified Disease     Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.57E-01; Fold-change: 6.95E-02; Z-score: 3.56E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8B01     Subarachnoid haemorrhage Click to Show/Hide
The Studied Tissue     Intracranial artery
The Specified Disease     Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.08E-03; Fold-change: 1.81E-01; Z-score: 1.97E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8B11     Cerebral ischaemic stroke Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.71E-01; Fold-change: 8.39E-03; Z-score: 3.95E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Peripheral blood
The Specified Disease     Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.38E-02; Fold-change: 4.92E-02; Z-score: 6.31E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8B60     Motor neuron disease Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.14E-01; Fold-change: 7.49E-02; Z-score: 1.11E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Cervical spinal cord
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.03E-01; Fold-change: -2.08E-03; Z-score: -9.42E-03
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8C70     Muscular dystrophy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.98E-01; Fold-change: -1.02E-01; Z-score: -6.90E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: 8C75     Distal myopathy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.13E-02; Fold-change: -4.37E-02; Z-score: -3.73E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 09 Visual system disease Click to Show/Hide
                  ICD-11: 9A96     Anterior uveitis Click to Show/Hide
The Studied Tissue     Peripheral monocyte
The Specified Disease     Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.86E-02; Fold-change: -7.09E-02; Z-score: -1.19E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 11 Circulatory system disease Click to Show/Hide
                  ICD-11: BA41     Myocardial infarction Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.39E-02; Fold-change: 1.07E-01; Z-score: 3.94E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: BA80     Coronary artery disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.39E-01; Fold-change: 5.91E-02; Z-score: 4.05E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: BB70     Aortic valve stenosis Click to Show/Hide
The Studied Tissue     Calcified aortic valve
The Specified Disease     Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.40E-01; Fold-change: -1.68E-02; Z-score: -3.18E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 12 Respiratory system disease Click to Show/Hide
                  ICD-11: 7A40     Central sleep apnoea Click to Show/Hide
The Studied Tissue     Hyperplastic tonsil
The Specified Disease     Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.00E-02; Fold-change: -5.54E-02; Z-score: -3.69E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CA08     Vasomotor or allergic rhinitis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.34E-01; Fold-change: -1.61E-02; Z-score: -1.81E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CA0A     Chronic rhinosinusitis Click to Show/Hide
The Studied Tissue     Sinus mucosa tissue
The Specified Disease     Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.16E-01; Fold-change: 5.43E-02; Z-score: 1.44E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CA22     Chronic obstructive pulmonary disease Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.41E-01; Fold-change: 3.17E-02; Z-score: 2.29E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Small airway epithelium
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.67E-01; Fold-change: 5.11E-02; Z-score: 1.35E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CA23     Asthma Click to Show/Hide
The Studied Tissue     Nasal and bronchial airway
The Specified Disease     Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.93E-03; Fold-change: -2.19E-01; Z-score: -4.49E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: CB03     Idiopathic interstitial pneumonitis Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.63E-01; Fold-change: 1.10E-01; Z-score: 2.91E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 13 Digestive system disease Click to Show/Hide
                  ICD-11: DA0C     Periodontal disease Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 6.62E-02; Fold-change: -4.45E-02; Z-score: -3.26E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
                  ICD-11: DA42     Gastritis Click to Show/Hide
The Studied Tissue     Gastric antrum tissue
The Specified Disease     Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 2.87E-02; Fold-change: -3.82E-01; Z-score: -3.30E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
                  ICD-11: DB92     Non-alcoholic fatty liver disease Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.31E-01; Fold-change: -2.72E-02; Z-score: -4.58E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: DB99     Hepatic failure Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.77E-03; Fold-change: -1.94E+00; Z-score: -8.02E+00
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: DD71     Ulcerative colitis Click to Show/Hide
The Studied Tissue     Colon mucosal tissue
The Specified Disease     Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.79E-01; Fold-change: -2.96E-03; Z-score: -2.74E-02
DME expression in the diseased tissue of patients
DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of the other disease section
                  ICD-11: DD91     Irritable bowel syndrome Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.41E-02; Fold-change: 8.09E-02; Z-score: 3.46E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 14 Skin disease Click to Show/Hide
                  ICD-11: EA80     Atopic eczema Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.96E-04; Fold-change: 9.62E-02; Z-score: 8.89E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: EA90     Psoriasis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.73E-03; Fold-change: 3.91E-02; Z-score: 2.20E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 6.45E-01; Fold-change: -4.26E-02; Z-score: -2.03E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue adjacent to the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
Download DME expression data in the tissue of healthy individual
                  ICD-11: ED63     Acquired hypomelanotic disorder Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.34E-01; Fold-change: -7.52E-02; Z-score: -5.09E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: ED70     Alopecia or hair loss Click to Show/Hide
The Studied Tissue     Skin from scalp
The Specified Disease     Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.37E-02; Fold-change: 1.39E-01; Z-score: 5.78E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: EK0Z     Contact dermatitis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.18E-01; Fold-change: 3.82E-02; Z-score: 5.52E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 15 Musculoskeletal system/connective tissue disease Click to Show/Hide
                  ICD-11: FA00     Osteoarthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.17E-01; Fold-change: -2.55E-02; Z-score: -1.87E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Synovial tissue
The Specified Disease     Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 8.71E-01; Fold-change: -6.68E-03; Z-score: -3.03E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: FA20     Rheumatoid arthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.66E-01; Fold-change: 2.12E-02; Z-score: 2.25E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
The Studied Tissue     Synovial tissue
The Specified Disease     Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.62E-02; Fold-change: -1.65E-01; Z-score: -6.38E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: FA24     Juvenile idiopathic arthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.81E-01; Fold-change: 5.13E-02; Z-score: 2.10E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: FA92     Inflammatory spondyloarthritis Click to Show/Hide
The Studied Tissue     Pheripheral blood
The Specified Disease     Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.98E-01; Fold-change: 2.18E-04; Z-score: 2.03E-03
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: FB83     Low bone mass disorder Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.23E-01; Fold-change: 4.59E-02; Z-score: 6.37E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 16 Genitourinary system disease Click to Show/Hide
                  ICD-11: GA10     Endometriosis Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.97E-02; Fold-change: -4.55E-02; Z-score: -3.54E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: GC00     Cystitis Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.00E-01; Fold-change: -2.09E-02; Z-score: -1.50E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 19 Condition originating in perinatal period Click to Show/Hide
                  ICD-11: KA21     Short gestation disorder Click to Show/Hide
The Studied Tissue     Myometrium
The Specified Disease     Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 7.88E-01; Fold-change: 1.19E-02; Z-score: 9.16E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
      ICD Disease Classification 20 Developmental anomaly Click to Show/Hide
                  ICD-11: LD2C     Overgrowth syndrome Click to Show/Hide
The Studied Tissue     Adipose tissue
The Specified Disease     Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.18E-01; Fold-change: -4.49E-03; Z-score: -3.72E-01
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
                  ICD-11: LD2D     Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide
The Studied Tissue     Perituberal tissue
The Specified Disease     Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.00E-01; Fold-change: -6.51E-03; Z-score: -3.20E-02
DME expression in the diseased tissue of patients
DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances Click to View the Clearer Original Diagram
Download DME expression barchart for all samples
Download DME expression data of patients in the disease section of the tissue
Download DME expression data in the tissue of healthy individual
References
1 Thalidomide metabolism by the CYP2C subfamily. Clin Cancer Res. 2002 Jun;8(6):1964-73.
2 Involvement of multiple cytochrome P450 isoforms in naproxen O-demethylation. Eur J Clin Pharmacol. 1997;52(4):293-8.
3 Role of cytochrome P450 2C8 in drug metabolism and interactions. Pharmacol Rev. 2016 Jan;68(1):168-241.
4 Role of cytochrome P450 in estradiol metabolism in vitro. Acta Pharmacol Sin. 2001 Feb;22(2):148-54.
5 DrugBank(Pharmacology-Metabolism)Estrone
6 Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70.
7 Apalutamide: first global approval. Drugs. 2018 Apr;78(6):699-705.
8 DrugBank(Pharmacology-Metabolism):Ozanimod
9 Analysis of human cytochrome P450 2C8 substrate specificity using a substrate pharmacophore and site-directed mutants. Biochemistry. 2004 Dec 14;43(49):15379-92.
10 Metabolic Profiles of Propofol and Fospropofol: Clinical and Forensic Interpretative Aspects
11 Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid. J Biol Chem. 2008 Jun 20;283(25):17227-37.
12 Buprenorphine in cancer pain. Support Care Cancer. 2005 Nov;13(11):878-87.
13 Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of rosiglitazone. Br J Clin Pharmacol. 1999 Sep;48(3):424-32.
14 Rosiglitazone Metabolism in Human Liver Microsomes Using a Substrate Depletion Method
15 DrugBank(Pharmacology-Metabolism):Rosiglitazone
16 DrugBank(Pharmacology-Metabolism):Almogran
17 Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
18 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
19 Pharmacokinetics and metabolism of 14C-brivaracetam, a novel SV2A ligand, in healthy subjects. Drug Metab Dispos. 2008 Jan;36(1):36-45.
20 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells Chem Res Toxicol. 2003 Mar;16(3):336-49. doi: 10.1021/tx025599q.
21 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
22 Examination of 209 drugs for inhibition of cytochrome P450 2C8. J Clin Pharmacol. 2005 Jan;45(1):68-78.
23 Enhanced cyclophosphamide and ifosfamide activation in primary human hepatocyte cultures: response to cytochrome P-450 inducers and autoinduction by oxazaphosphorines. Cancer Res. 1997 May 15;57(10):1946-54.
24 Mechanism-based inactivation of cytochrome P450 3A4 by lapatinib. Mol Pharmacol. 2010 Oct;78(4):693-703.
25 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
26 CYP2C76-mediated species difference in drug metabolism: a comparison of pitavastatin metabolism between monkeys and humans
27 Metabolic fate of pitavastatin (NK-104), a new inhibitor of 3-hydroxy-3-methyl-glutaryl coenzyme A reductase. Effects on drug-metabolizing systems in rats and humans
28 Metabolic fate of pitavastatin, a new inhibitor of HMG-CoA reductase: similarities and difference in the metabolism of pitavastatin in monkeys and humans
29 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
30 Effect of rifampicin on the pharmacokinetics of pioglitazone
31 Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
32 DAILYMED.nlm.nih.gov: JEVTANA- cabazitaxel kit.
33 [Enzalutamide in castration resistant prostate cancer.]
34 In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition Xenobiotica. 2008 May;38(5):496-510. doi: 10.1080/00498250801956350.
35 Metabolism, excretion and pharmacokinetics of [14C]glasdegib (PF-04449913) in healthy volunteers following oral administration. Xenobiotica. 2017 Dec;47(12):1064-1076.
36 Ninlaro- European Medicines Agency - European Union
37 The role of human CYP2C8 and CYP2C9 variants in pioglitazone metabolism in vitro. Basic Clin Pharmacol Toxicol. 2009 Dec;105(6):374-9.
38 The pharmacology and clinical pharmacokinetics of apomorphine SL BJU Int. 2001 Oct;88 Suppl 3:18-21. doi: 10.1046/j.1464-4096.2001.00124.x.
39 Genetic polymorphism of cytochrome P450 2D6 determines oestrogen receptor activity of the major infertility drug clomiphene via its active metabolites
40 Body weight, gender and pregnancy affect enantiomer-specific ketorolac pharmacokinetics. Br J Clin Pharmacol. 2017 Sep;83(9):1966-1975.
41 Viral target and metabolism-based rationale for combined use of recently authorized small molecule COVID-19 medicines: Molnupiravir, nirmatrelvir, and remdesivir
42 Open-label, single-center, phase I trial to investigate the mass balance and absolute bioavailability of the highly selective oral MET inhibitor tepotinib in healthy volunteers
43 Identification of Iminium Intermediates Generation in the Metabolism of Tepotinib Using LC-MS/MS: In Silico and Practical Approaches to Bioactivation Pathway Elucidation
44 Pharmacokinetics and drug interactions of eslicarbazepine acetate Epilepsia. 2012 Jun;53(6):935-46. doi: 10.1111/j.1528-1167.2012.03519.x.
45 Elimination of tucatinib, a small molecule kinase inhibitor of HER2, is primarily governed by CYP2C8 enantioselective oxidation of gem-dimethyl
46 PharmGKB summary: caffeine pathway. Pharmacogenet Genomics. 2012 May;22(5):389-95.
47 Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
48 Use of inhibitory monoclonal antibodies to assess the contribution of cytochromes P450 to human drug metabolism. Eur J Pharmacol. 2000 Apr 14;394(2-3):199-209.
49 Reversible inhibition of four important human liver cytochrome P450 enzymes by diethylstilbestrol. Pharmazie. 2011 Mar;66(3):216-21.
50 Clinical pharmacokinetics of ketoprofen enantiomers in wild type of Cyp 2c8 and Cyp 2c9 patients with rheumatoid arthritis Eur J Drug Metab Pharmacokinet. 2011 Sep;36(3):167-73. doi: 10.1007/s13318-011-0041-1.
51 Identification of the human P450 enzymes involved in lansoprazole metabolism. J Pharmacol Exp Ther. 1996 May;277(2):805-16.
52 Clinical pharmacokinetics and pharmacodynamics of the endothelin receptor antagonist macitentan
53 Drug-drug and food-drug pharmacokinetic interactions with new insulinotropic agents repaglinide and nateglinide. Clin Pharmacokinet. 2007;46(2):93-108.
54 Pioglitazone is metabolised by CYP2C8 and CYP3A4 in vitro: potential for interactions with CYP2C8 inhibitors. Basic Clin Pharmacol Toxicol. 2006 Jul;99(1):44-51.
55 Differential expression and function of CYP2C isoforms in human intestine and liver. Pharmacogenetics. 2003 Sep;13(9):565-75.
56 The xenobiotic inhibitor profile of cytochrome P4502C8. Br J Clin Pharmacol. 2000 Dec;50(6):573-80.
57 Brigatinib: first global approval. Drugs. 2017 Jul;77(10):1131-1135.
58 Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
59 Absorption, metabolism and excretion of [(14)C]-sotorasib in healthy male subjects: characterization of metabolites and a minor albumin-sotorasib conjugate
60 Potential interaction between ritonavir and carbamazepine. Pharmacotherapy. 2000 Jul;20(7):851-4.
61 Role of CYP3A4 in human hepatic diltiazem N-demethylation: inhibition of CYP3A4 activity by oxidized diltiazem metabolites. J Pharmacol Exp Ther. 1997 Jul;282(1):294-300.
62 Comparison of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitors (statins) as inhibitors of cytochrome P450 2C8. Basic Clin Pharmacol Toxicol. 2005 Aug;97(2):104-8.
63 Influence of CYP2C8 polymorphisms on the hydroxylation metabolism of paclitaxel, repaglinide and ibuprofen enantiomers in vitro. Biopharm Drug Dispos. 2013 Jul;34(5):278-87.
64 Human cytochrome P450s involved in the metabolism of 9-cis- and 13-cis-retinoic acids
65 Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
66 In vitro metabolism study of buprenorphine: evidence for new metabolic pathways. Drug Metab Dispos. 2005 May;33(5):689-95.
67 Drug interactions with lipid-lowering drugs: mechanisms and clinical relevance. Clin Pharmacol Ther. 2006 Dec;80(6):565-81.
68 DrugBank(Pharmacology-Metabolism):Simvastatin
69 Functional characterization of five novel CYP2C8 variants, G171S, R186X, R186G, K247R, and K383N, found in a Japanese population. Drug Metab Dispos. 2005 May;33(5):630-6.
70 In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
71 Azelastine N-demethylation by cytochrome P-450 (CYP)3A4, CYP2D6, and CYP1A2 in human liver microsomes: evaluation of approach to predict the contribution of multiple CYPs. Drug Metab Dispos. 1999 Dec;27(12):1381-91.
72 Bedaquiline metabolism: enzymes and novel metabolites. Drug Metab Dispos. 2014 May;42(5):863-6.
73 Effects of Rifamycin Coadministration on Bedaquiline Desmethylation in Healthy Adult Volunteers
74 Clinical Pharmacokinetics and Pharmacodynamics of Cabozantinib Clin Pharmacokinet. 2017 May;56(5):477-491. doi: 10.1007/s40262-016-0461-9.
75 Elucidation of individual cytochrome P450 enzymes involved in the metabolism of clozapine. Naunyn Schmiedebergs Arch Pharmacol. 1998 Nov;358(5):592-9.
76 Human CYP2C19 is a major omeprazole 5-hydroxylase, as demonstrated with recombinant cytochrome P450 enzymes. Drug Metab Dispos. 1996 Oct;24(10):1081-7.
77 Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35.
78 Identification of the human cytochrome P450 isoforms mediating in vitro N-dealkylation of perphenazine. Br J Clin Pharmacol. 2000 Dec;50(6):563-71.
79 Identification of cytochromes P450 2C9 and 3A4 as the major catalysts of phenprocoumon hydroxylation in vitro. Eur J Clin Pharmacol. 2004 May;60(3):173-82.
80 Novel Pathways of Ponatinib Disposition Catalyzed By CYP1A1 Involving Generation of Potentially Toxic Metabolites J Pharmacol Exp Ther. 2017 Oct;363(1):12-19. doi: 10.1124/jpet.117.243246.
81 Possible involvement of multiple human cytochrome P450 isoforms in the liver metabolism of propofol. Br J Anaesth. 1998 Jun;80(6):788-95.
82 Sulfamethoxazole and its metabolite nitroso sulfamethoxazole stimulate dendritic cell costimulatory signaling. J Immunol. 2007 May 1;178(9):5533-42.
83 Mechanism-based inactivation of human cytochrome P4502C8 by drugs in vitro. J Pharmacol Exp Ther. 2004 Dec;311(3):996-1007.
84 FDA label of Treprostinil. The 2020 official website of the U.S. Food and Drug Administration.
85 Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
86 Apixaban. Hosp Pharm. 2013 Jun;48(6):494-509.
87 Further characterization of the metabolism of desloratadine and its cytochrome P450 and UDP-glucuronosyltransferase inhibition potential: identification of desloratadine as a relatively selective UGT2B10 inhibitor. Drug Metab Dispos. 2015 Sep;43(9):1294-302.
88 Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
89 N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
90 The role of levomilnacipran in the management of major depressive disorder: a comprehensive review. Curr Neuropharmacol. 2016;14(2):191-9.
91 Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes. Eur J Clin Pharmacol. 2004 Oct;60(8):575-81.
92 Drug-drug interaction between losartan and paclitaxel in human liver microsomes with different CYP2C8 genotypes. Basic Clin Pharmacol Toxicol. 2015 Jun;116(6):493-8.
93 Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
94 Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
95 Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
96 Characterization of a phase 1 metabolite of mycophenolic acid produced by CYP3A4/5. Ther Drug Monit. 2004 Dec;26(6):600-8.
97 DrugBank(Pharmacology-Metabolism):Mycophenolic acid
98 Effects of acid and lactone forms of eight HMG-CoA reductase inhibitors on CYP-mediated metabolism and MDR1-mediated transport. Pharm Res. 2006 Mar;23(3):506-12.
99 Drug-interaction between paclitaxel and goshajinkigan extract and its constituents
100 Colchicine down-regulates cytochrome P450 2B6, 2C8, 2C9, and 3A4 in human hepatocytes by affecting their glucocorticoid receptor-mediated regulation. Mol Pharmacol. 2003 Jul;64(1):160-9.
101 Efficacy of piroxicam for postoperative pain after lower third molar surgery associated with CYP2C8*3 and CYP2C9 J Pain Res. 2017 Jul 6;10:1581-1589.
102 Comparison of the safety, tolerability, and pharmacokinetic profile of a single oral dose of pitavastatin 4 mg in adult subjects with severe renal impairment not on hemodialysis versus healthy adult subjects. J Cardiovasc Pharmacol. 2012 Jul;60(1):42-8.
103 Riociguat (adempas): a novel agent for the treatment of pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension. P T. 2014 Nov;39(11):749-58.
104 Pharmacokinetics of dipeptidylpeptidase-4 inhibitors. Diabetes Obes Metab. 2010 Aug;12(8):648-58.
105 Interaction of sorafenib and cytochrome P450 isoenzymes in patients with advanced melanoma: a phase I/II pharmacokinetic interaction study. Cancer Chemother Pharmacol. 2011 Nov;68(5):1111-8.
106 Reduction of sulfamethoxazole and dapsone hydroxylamines by a microsomal enzyme system purified from pig liver and pig and human liver microsomes. Life Sci. 2005 May 27;77(2):205-19.
107 Selective inhibition of CYP2C8 by fisetin and its methylated metabolite, geraldol, in human liver microsomes
108 Polymorphisms of CYP2C8 Alter First-Electron Transfer Kinetics and Increase Catalytic Uncoupling
109 The Quantification of Paclitaxel and Its Two Major Metabolites in Biological Samples by HPLC-MS/MS and Its Application in a Pharmacokinetic and Tumor Distribution Study in Xenograft Nude Mouse
110 Cytochrome P450 2C8 and flavin-containing monooxygenases are involved in the metabolism of tazarotenic acid in humans. Drug Metab Dispos. 2003 Apr;31(4):476-81.
111 Timolol metabolism in human liver microsomes is mediated principally by CYP2D6. Drug Metab Dispos. 2007 Jul;35(7):1135-41.
112 Prediction of in vivo drug-drug interactions between tolbutamide and various sulfonamides in humans based on in vitro experiments. Drug Metab Dispos. 2000 Apr;28(4):475-81.
113 Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance. Clin Pharmacokinet. 2005;44(12):1209-25.
114 Development, validation and application of the liquid chromatography tandem mass spectrometry method for simultaneous quantification of azilsartan medoxomil (TAK-491), azilsartan (TAK-536), and its 2 metabolites in human plasma
115 Drug Interactions with Angiotensin Receptor Blockers: Role of Human Cytochromes P450
116 Lithium Intoxication in the Elderly: A Possible Interaction between Azilsartan, Fluvoxamine, and Lithium
117 Critical evaluation of the efficacy and tolerability of azilsartan
118 Cytochrome P450 2C8 pharmacogenetics: a review of clinical studies. Pharmacogenomics. 2009 Sep;10(9):1489-510.
119 CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
120 Eltrombopag-induced acute liver failure in a pediatric patient: a pharmacokinetic and pharmacogenetic analysis. Ther Drug Monit. 2018 Aug;40(4):386-388.
121 LABEL:DDYI- flibanserin tablet, film coated
122 Evaluation of the effects of the weak CYP3A inhibitors atorvastatin and ethinyl estradiol/norgestimate on lomitapide pharmacokinetics in healthy subjects. J Clin Pharmacol. 2016 Jan;56(1):47-55.
123 Evidence that CYP2C19 is the major (S)-mephenytoin 4'-hydroxylase in humans. Biochemistry. 1994 Feb 22;33(7):1743-52.
124 Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
125 Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102.
126 FDA Label of Uptravi. The 2020 official website of the U.S. Food and Drug Administration.
127 Sigmoidal kinetic model for two co-operative substrate-binding sites in a cytochrome P450 3A4 active site: an example of the metabolism of diazepam and its derivatives. Biochem J. 1999 Jun 15;340 ( Pt 3):845-53.
128 Cytochrome P450 isozymes responsible for the metabolism of toluene and styrene in human liver microsomes. Xenobiotica. 1997 Jul;27(7):657-65.
129 Short communication: high prevalence of the cytochrome P450 2C8*2 mutation in Northern Ghana. Trop Med Int Health. 2005 Dec;10(12):1271-3.
130 Metabolism and Interactions of Chloroquine and Hydroxychloroquine with Human Cytochrome P450 Enzymes and Drug Transporters Curr Drug Metab. 2020;21(14):1127-1135. doi: 10.2174/1389200221999201208211537.
131 FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
132 Halofantrine metabolism in microsomes in man: major role of CYP 3A4 and CYP 3A5. J Pharm Pharmacol. 1999 Apr;51(4):419-26.
133 FDA label of Lorlatinib. The 2020 official website of the U.S. Food and Drug Administration.
134 Genetically based impairment in CYP2C8- and CYP2C9-dependent NSAID metabolism as a risk factor for gastrointestinal bleeding: is a combination of pharmacogenomics and metabolomics required to improve personalized medicine? Expert Opin Drug Metab Toxicol. 2009 Jun;5(6):607-20.
135 An Efficient UPLC-MS/MS Method Established to Detect Relugolix Concentration in Rat Plasma
136 Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7.
137 FDA Label of Vosevi. The 2020 official website of the U.S. Food and Drug Administration.
138 Preclinical Pharmacokinetics and First-in-Human Pharmacokinetics, Safety, and Tolerability of Velpatasvir, a Pangenotypic Hepatitis C Virus NS5A Inhibitor, in Healthy Subjects
139 DrugBank(Pharmacology-Metabolism):Voxilaprevir
140 DrugBank(Pharmacology-Metabolism):Elagolix sodium
141 Pharmacokinetic comparison of the potential over-the-counter statins simvastatin, lovastatin, fluvastatin and pravastatin. Clin Pharmacokinet. 2008;47(7):463-74.
142 Delta-9-Tetrahydrocannabinol and Cannabidiol Drug-Drug Interactions
143 FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
144 Metabolism and disposition of pan-genotypic inhibitor of hepatitis C virus NS5A ombitasvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1148-57.
145 Loss of orally administered drugs in GI tract. Saudi Pharm J. 2012 Oct;20(4):331-44.
146 Ketobemidone is a substrate for cytochrome P4502C9 and 3A4, but not for P-glycoprotein. Xenobiotica. 2005 Aug;35(8):785-96.
147 Cardiovascular concentration-effect relationships of amodiaquine and its metabolite desethylamodiaquine: Clinical and preclinical studies. Br J Clin Pharmacol. 2023 Mar;89(3):1176-1186. doi: 10.1111/bcp.15569.
148 Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93.
149 Cytochrome P-450 3A4 and 2C8 are involved in zopiclone metabolism. Drug Metab Dispos. 1999 Sep;27(9):1068-73.
150 Excretion and metabolism of milnacipran in humans after oral administration of milnacipran hydrochloride Drug Metab Dispos. 2012 Sep;40(9):1723-35. doi: 10.1124/dmd.112.045120.
151 FDA LABEL:Milnacipran
152 In vitro metabolism and inhibitory effects of pranlukast in human liver microsomes
153 Evaluation of drug-drug interaction potential of beraprost sodium mediated by P450 in vitro. Yakugaku Zasshi. 2008 Oct;128(10):1459-65.
154 Gemfibrozil and its glucuronide inhibit the organic anion transporting polypeptide 2 (OATP2/OATP1B1:SLC21A6)-mediated hepatic uptake and CYP2C8-mediated metabolism of cerivastatin: analysis of the mechanism of the clinically relevant drug-drug interaction between cerivastatin and gemfibrozil. J Pharmacol Exp Ther. 2004 Oct;311(1):228-36.
155 Metabolism, Excretion, and Pharmacokinetics of Selumetinib, an MEK1/2 inhibitor, in Healthy Adult Male Subjects
156 Effect of Kidney Function and Dialysis on the Pharmacokinetics and Pharmacodynamics of Roxadustat, an Oral Hypoxia-Inducible Factor Prolyl Hydroxylase Inhibitor
157 Identification of cytochrome P450 enzymes involved in the metabolism of 4'-methoxy-alpha-pyrrolidinopropiophenone (MOPPP), a designer drug, in human liver microsomes. Xenobiotica. 2003 Oct;33(10):989-98.
158 Involvement of multiple cytochrome P450 and UDP-glucuronosyltransferase enzymes in the in vitro metabolism of muraglitazar. Drug Metab Dispos. 2007 Jan;35(1):139-49.
159 Biotransformation of Finerenone, a Novel Nonsteroidal Mineralocorticoid Receptor Antagonist, in Dogs, Rats, and Humans, In Vivo and In Vitro
160 Aldosterone and Mineralocorticoid Receptor Signaling as Determinants of Cardiovascular and Renal Injury: From Hans Selye to the Present
161 Results From Drug-Drug Interaction Studies In Vitro and In Vivo Investigating the Inhibitory Effect of Finerenone on the Drug Transporters BCRP, OATP1B1, and OATP1B3
162 Pharmacokinetics of the Novel, Selective, Non-steroidal Mineralocorticoid Receptor Antagonist Finerenone in Healthy Volunteers: Results from an Absolute Bioavailability Study and Drug-Drug Interaction Studies In Vitro and In Vivo
163 The prokinetic cinitapride has no clinically relevant pharmacokinetic interaction and effect on QT during coadministration with ketoconazole. Drug Metab Dispos. 2007 Jul;35(7):1149-56.
164 Metabolism and disposition of hepatitis C polymerase inhibitor dasabuvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1139-47.
165 Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
166 Characterization of the metabolism of fenretinide by human liver microsomes, cytochrome P450 enzymes and UDP-glucuronosyltransferases. Br J Pharmacol. 2011 Feb;162(4):989-99.
167 Effects of arachidonic acid, prostaglandins, retinol, retinoic acid and cholecalciferol on xenobiotic oxidations catalysed by human cytochrome P450 enzymes. Xenobiotica. 1999 Mar;29(3):231-41.
168 CYP26C1 is a hydroxylase of multiple active retinoids and interacts with cellular retinoic acid binding proteins. Mol Pharmacol. 2018 May;93(5):489-503.
169 Metabolism and disposition of the SGLT2 inhibitor bexagliflozin in rats, monkeys and humans
170 Effects of gemfibrozil, itraconazole, and their combination on the pharmacokinetics of pioglitazone. Clin Pharmacol Ther. 2005 May;77(5):404-14.
171 Cytochromes P450 2C8 and 3A Catalyze the Metabolic Activation of the Tyrosine Kinase Inhibitor Masitinib
172 Absorption, Distribution, Metabolism, and Excretion of [(14)C]iptacopan in Healthy Male Volunteers and in In Vivo and In Vitro Studies
173 Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
174 DrugBank(Pharmacology-Metabolism):TAK-491
175 Evaluation of in vitro drug interactions with karenitecin, a novel, highly lipophilic camptothecin derivative in phase II clinical development. J Clin Pharmacol. 2003 Sep;43(9):1008-14.
176 DrugBank(Pharmacology-Metabolism):MRTX849
177 DrugBank(Pharmacology-Metabolism):Ag-221
178 In vitro metabolism of rivoglitazone, a novel peroxisome proliferator-activated receptor gama agonist, in rat, monkey, and human liver microsomes and freshly isolated hepatocytes. Drug Metab Dispos. 2011 Jul;39(7):1311-9.
179 Pharmacokinetics and disposition of momelotinib revealed a disproportionate human metabolite-resolution for clinical development. Drug Metab Dispos. 2018 Mar;46(3):237-247.
180 Quantitative Assessment of Elagolix Enzyme-Transporter Interplay and Drug-Drug Interactions Using Physiologically Based Pharmacokinetic Modeling
181 A Pharmacokinetic, Safety, and Tolerability Trial of Palovarotene in Healthy Japanese and Non-Japanese Participants
182 Accelerating Clinical Development of Idasanutlin through a Physiologically Based Pharmacokinetic Modeling Risk Assessment for CYP450 Isoenzyme-Related Drug-Drug Interactions
183 Lactobacillus rhamnosus induces CYP3A and changes the pharmacokinetics of verapamil in rats
184 A Mechanistic, Enantioselective, Physiologically Based Pharmacokinetic Model of Verapamil and Norverapamil, Built and Evaluated for Drug-Drug Interaction Studies
185 In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
186 Increased serum amiodarone concentration in hypertriglyceridemic patients: Effects of drug distribution to serum lipoproteins
187 The Effect of Modafinil on the Safety and Pharmacokinetics of Lorlatinib: A Phase I Study in Healthy Participants
188 Phenotypic and metabolic investigation of a CSF-1R kinase receptor inhibitor (BLZ945) and its pharmacologically active metabolite
189 Pharmacokinetics, pharmacodynamics and safety of single, oral doses of GSK1278863, a novel HIF-prolyl hydroxylase inhibitor, in healthy Japanese and Caucasian subjects. Drug Metab Pharmacokinet. 2015 Dec;30(6):410-8.
190 Pharmacokinetics, metabolism, and excretion of licogliflozin, a dual inhibitor of SGLT1/2, in rats, dogs, and humans
191 First-in-human pharmacokinetic and pharmacodynamic study of the dual m-TORC 1/2 inhibitor AZD2014. Clin Cancer Res. 2015 Aug 1;21(15):3412-9.
192 Evaluation of the Absorption, Metabolism, and Excretion of a Single Oral 1-mg Dose of Tropifexor in Healthy Male Subjects and the Concentration Dependence of Tropifexor Metabolism
193 DrugBank(Pharmacology-Metabolism):AP26113
194 Predicting the drug interaction potential of AMG 853, a dual antagonist of the D-prostanoid and chemoattractant receptor-homologous molecule expressed on T helper 2 cells receptors
195 Phosphonate O-deethylation of [4-(4-bromo-2-cyano-phenylcarbamoyl) benzyl]-phosphonic acid diethyl ester, a lipoprotein lipase-promoting agent, catalyzed by cytochrome P450 2C8 and 3A4 in human liver microsomes
196 Oxidative metabolism of razuprotafib (AKB-9778), a sulfamic acid phosphatase inhibitor, in human microsomes and recombinant human CYP2C8 enzyme
197 Pharmacokinetics, tissue distribution and identification of putative metabolites of JI-101 - a novel triple kinase inhibitor in rats
198 Metabolism and Disposition of Verinurad, a Uric Acid Reabsorption Inhibitor, in Humans
199 Disposition and metabolic profiling of [(14)C]cerlapirdine using accelerator mass spectrometry
200 Effect of human flavin-containing monooxygenase 3 polymorphism on the metabolism of aurora kinase inhibitors
201 In vitro metabolism, pharmacokinetics and drug interaction potentials of emvododstat, a DHODH inhibitor
202 Pre-clinical Characterization of Absorption, Distribution, Metabolism and Excretion Properties of TAK-063
203 Evaluation of the drug-drug interaction potential for trazpiroben (TAK-906), a D(2)/D(3) receptor antagonist for gastroparesis, towards cytochrome P450s and transporters
204 Review of Clinically Relevant Drug Interactions with Next Generation Hepatitis C Direct-acting Antiviral Agents
205 DrugBank(Pharmacology-Metabolism):KD025
206 Pharmacokinetics, safety, and CCR2/CCR5 antagonist activity of cenicriviroc in participants with mild or moderate hepatic impairment. Clin Transl Sci. 2016 Jun;9(3):139-48.
207 Safety, Tolerability and Pharmacokinetics of Vidofludimus calcium (IMU-838) After Single and Multiple Ascending Oral Doses in Healthy Male Subjects
208 Identification of enzymes responsible for primary and sequential oxygenation reactions of capravirine in human liver microsomes. Drug Metab Dispos. 2006 Nov;34(11):1798-802.
209 In vitro metabolism of irosustat, a novel steroid sulfatase inhibitor: interspecies comparison, metabolite identification, and metabolic enzyme identification
210 Disposition and metabolism of the cathepsin K inhibitor odanacatib in humans. Drug Metab Dispos. 2014 May;42(5):818-27.
211 Metabolism and pharmacokinetics of allitinib in cancer patients: the roles of cytochrome P450s and epoxide hydrolase in its biotransformation
212 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
213 Steady-state pharmacokinetics of a new antipsychotic agent perospirone and its active metabolite, and its relationship with prolactin response. Ther Drug Monit. 2004 Aug;26(4):361-5.
214 In vitro metabolism of 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin in human liver microsomes
215 In vitro and in vivo clinical pharmacology of dimethyl benzoylphenylurea, a novel oral tubulin-interactive agent
216 Phase I study of continuous weekly dosing of dimethylamino benzoylphenylurea (BPU) in patients with solid tumours
217 Complete substrate inhibition of cytochrome P450 2C8 by AZD9496, an oral selective estrogen receptor degrader. Drug Metab Dispos. 2018 Sep;46(9):1268-1276.
218 DrugBank(Pharmacology-Metabolism):ARRY-380
219 Cilomilast: a second generation phosphodiesterase 4 inhibitor for asthma and chronic obstructive pulmonary disease
220 Disposition and metabolism of darapladib, a lipoprotein-associated phospholipase A2 inhibitor, in humans
221 In vitro metabolism of 7 neuronal nicotinic receptor agonist AZD0328 and enzyme identification for its N-oxide metabolite
222 Behavior of thymidylate kinase toward monophosphate metabolites and its role in the metabolism of 1-(2'-deoxy-2'-fluoro-beta-L-arabinofuranosyl)-5-methyluracil (Clevudine) and 2',3'-didehydro-2',3'-dideoxythymidine in cells. Antimicrob Agents Chemother. 2005 May;49(5):2044-9. doi: 10.1128/AAC.49.5.2044-2049.2005.
223 Exposure and response analysis of aleglitazar on cardiovascular risk markers and safety outcomes: an analysis of the AleCardio trial. Diabetes Obes Metab. 2020 Jan;22(1):30-38.
224 Identification of cytochromes P450 involved in the human liver microsomal metabolism of the thromboxane A2 inhibitor seratrodast (ABT-001). Drug Metab Dispos. 1997 Jan;25(1):110-5.
225 Role of cytochrome P450 enzymes in the bioactivation of polyunsaturated fatty acids. Biochim Biophys Acta. 2011 Jan;1814(1):210-22.
226 The omega-hydroxlyation of lauric acid: oxidation of 12-hydroxlauric acid to dodecanedioic acid by a purified recombinant fusion protein containing P450 4A1 and NADPH-P450 reductase
227 Cytochrome P450 4A11 inhibition assays based on characterization of lauric acid metabolites
228 Characterization of human cytochrome P450 enzymes involved in the metabolism of cyamemazine. Eur J Pharm Sci. 2007 Dec;32(4-5):357-66.
229 The metabolism of diclofenac--enzymology and toxicology perspectives
230 Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.
231 High-performance liquid chromatographic determination of seratrodast and its metabolites in human serum and urine
232 Clinical pharmacokinetics of almotriptan, a serotonin 5-HT(1B/1D) receptor agonist for the treatment of migraine. Clin Pharmacokinet. 2005;44(3):237-46.
233 Cytochromes P450: a structure-based summary of biotransformations using representative substrates Drug Metab Rev. 2008;40(1):1-100. doi: 10.1080/03602530802309742.
234 Determination of the cardiac drug amiodarone and its N-desethyl metabolite in sludge samples
235 Amiodarone and concurrent antiretroviral therapy: a case report and review of the literature
236 The metabolism of amiodarone by various CYP isoenzymes of human and rat, and the inhibitory influence of ketoconazole. J Pharm Pharm Sci. 2008;11(1):147-59.
237 Apalutamide Absorption, Metabolism, and Excretion in Healthy Men, and Enzyme Reaction in Human Hepatocytes Drug Metab Dispos. 2019 May;47(5):453-464. doi: 10.1124/dmd.118.084517.
238 Apixaban. After hip or knee replacement: LMWH remains the standard treatment. Prescrire Int. 2012 Sep;21(130):201-2, 204.
239 Phase I study of orally administered (14)Carbon-isotope labelled-vistusertib (AZD2014), a dual TORC1/2 kinase inhibitor, to assess the absorption, metabolism, excretion, and pharmacokinetics in patients with advanced solid malignancies
240 LABEL: JUXTAPID- lomitapide mesylate capsule
241 Glucuronidation as a major metabolic clearance pathway of 14c-labeled muraglitazar in humans: metabolic profiles in subjects with or without bile collection Drug Metab Dispos. 2006 Mar;34(3):427-39. doi: 10.1124/dmd.105.007617.
242 U. S. FDA Label -BNP-1350
243 A phase I open-label study investigating the disposition of [14C]-cabazitaxel in patients with advanced solid tumors Anticancer Drugs. 2015 Mar;26(3):350-8. doi: 10.1097/CAD.0000000000000185.
244 Urine caffeine metabolites are positively associated with cognitive performance in older adults: An analysis of US National Health and Nutrition Examination Survey (NHANES) 2011 to 2014. Nutr Res. 2023 Jan;109:12-25. doi: 10.1016/j.nutres.2022.11.002.
245 Carbamazepine and its metabolites in human perfused placenta and in maternal and cord blood Epilepsia. 1995 Mar;36(3):241-8. doi: 10.1111/j.1528-1157.1995.tb00991.x.
246 Celecoxib pathways: pharmacokinetics and pharmacodynamics. Pharmacogenet Genomics. 2012 Apr;22(4):310-8.
247 DrugBank(Pharmacology-Metabolism)Cerivastatin
248 Clinical pharmacokinetics and metabolism of chloroquine. Focus on recent advancements Clin Pharmacokinet. 1996 Oct;31(4):257-74. doi: 10.2165/00003088-199631040-00003.
249 Cytochrome P450 2C8 and CYP3A4/5 are involved in chloroquine metabolism in human liver microsomes. Arch Pharm Res. 2003 Aug;26(8):631-7.
250 In Vitro metabolism of ciclesonide in human lung and liver precision-cut tissue slices Biopharm Drug Dispos. 2006 May;27(4):197-207. doi: 10.1002/bdd.500.
251 Clinical pharmacology of Cilomilast
252 Active cyamemazine metabolites in patients treated with cyamemazine (Tercian?): influence on cerebral dopamine D2 and serotonin 5-HT (2A) receptor occupancy as measured by positron emission tomography (PET)
253 Metabolism and disposition of oral dabrafenib in cancer patients: proposed participation of aryl nitrogen in carbon-carbon bond cleavage via decarboxylation following enzymatic oxidation
254 A long-standing mystery solved: the formation of 3-hydroxydesloratadine is catalyzed by CYP2C8 but prior glucuronidation of desloratadine by UDP-glucuronosyltransferase 2B10 is an obligatory requirement Drug Metab Dispos. 2015 Apr;43(4):523-33. doi: 10.1124/dmd.114.062620.
255 Plasma and synovial fluid concentrations of diclofenac sodium and its major hydroxylated metabolites during long-term treatment of rheumatoid arthritis Eur J Clin Pharmacol. 1983;25(3):389-94. doi: 10.1007/BF01037953.
256 Simultaneous determination of diclofenac sodium and its hydroxy metabolites by capillary column gas chromatography with electron-capture detection J Chromatogr. 1981 Nov 6;217:263-71. doi: 10.1016/s0021-9673(00)88081-4.
257 Eltrombopag for use in children with immune thrombocytopenia. Blood Adv. 2018 Feb 27;2(4):454-461.
258 FDA:Enasidenib
259 Pharmacokinetic Aspects of the Two Novel Oral Drugs Used for Metastatic Castration-Resistant Prostate Cancer: Abiraterone Acetate and Enzalutamide
260 Clinical Pharmacokinetic Studies of Enzalutamide
261 Absorption, Distribution, Metabolism, and Excretion of the Androgen Receptor Inhibitor Enzalutamide in Rats and Dogs
262 In Vitro Characterization of Ertugliflozin Metabolism by UDP-Glucuronosyltransferase and Cytochrome P450 Enzymes Drug Metab Dispos. 2020 Dec;48(12):1350-1363. doi: 10.1124/dmd.120.000171.
263 Pharmacokinetics, metabolism, and excretion of the antidiabetic agent ertugliflozin (PF-04971729) in healthy male subjects Drug Metab Dispos. 2013 Feb;41(2):445-56. doi: 10.1124/dmd.112.049551.
264 Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms. Endocrinology. 2003 Aug;144(8):3382-98.
265 Synthetic and natural compounds that interact with human cytochrome P450 1A2 and implications in drug development. Curr Med Chem. 2009;16(31):4066-218.
266 Development of a novel tandem mass spectrometry method for the quantification of eszopiclone without interference from 2-amino-5-chloropyridine and application in a pharmacokinetic study of rat J Pharm Biomed Anal. 2020 Sep 5;188:113363. doi: 10.1016/j.jpba.2020.113363.
267 Sulfotransferase 1E1 is a low km isoform mediating the 3-O-sulfation of ethinyl estradiol Drug Metab Dispos. 2004 Nov;32(11):1299-303. doi: 10.1124/dmd.32.11..
268 In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition. Xenobiotica. 2008 May;38(5):496-510.
269 Identification of Hypoxia-inducible factor (HIF) stabilizer roxadustat and its possible metabolites in thoroughbred horses for doping control
270 Roles of different CYP enzymes in the formation of specific fluvastatin metabolites by human liver microsomes. Basic Clin Pharmacol Toxicol. 2009 Nov;105(5):327-32.
271 Metabolism and transport of oxazaphosphorines and the clinical implications Drug Metab Rev. 2005;37(4):611-703. doi: 10.1080/03602530500364023.
272 Assessment of ifosfamide pharmacokinetics, toxicity, and relation to CYP3A4 activity as measured by the erythromycin breath test in patients with sarcoma Cancer. 2007 Jun 1;109(11):2315-22. doi: 10.1002/cncr.22669.
273 The single dose kinetics of chloroquine and its major metabolite desethylchloroquine in healthy subjects
274 Pharmacokinetics and metabolism of NO-1886, a lipoprotein lipase-promoting agent, in cynomolgus monkey
275 The KEGG resource for deciphering the genome
276 Role of cytochrome P450 activity in the fate of anticancer agents and in drug resistance: focus on tamoxifen, paclitaxel and imatinib metabolism
277 Participation of CYP2C8 and CYP3A4 in the N-demethylation of imatinib in human hepatic microsomes
278 In vitro biotransformation of imatinib by the tumor expressed CYP1A1 and CYP1B1
279 Clinical pharmacokinetics of ketoprofen enantiomers in wild type of Cyp 2c8 and Cyp 2c9 patients with rheumatoid arthritis. Eur J Drug Metab Pharmacokinet. 2011 Sep;36(3):167-73.
280 Characterization and quantification of metabolites of racemic ketoprofen excreted in urine following oral administration to man by 1H-NMR spectroscopy, directly coupled HPLC-MS and HPLC-NMR, and circular dichroism Xenobiotica. 2004 Nov-Dec;34(11-12):1075-89. doi: 10.1080/00498250412331281098.
281 Identification and structural characterization of in vivo metabolites of ketorolac using liquid chromatography electrospray ionization tandem mass spectrometry (LC/ESI-MS/MS) J Mass Spectrom. 2012 Jul;47(7):919-31. doi: 10.1002/jms.3043.
282 Label:KLH-2109
283 Metabolic intermediate complex formation of human cytochrome P450 3A4 by lapatinib Drug Metab Dispos. 2011 Jun;39(6):1022-30. doi: 10.1124/dmd.110.037531.
284 Pharmacokinetics and metabolism of LNP023 in rats by liquid chromatography combined with electrospray ionization-tandem mass spectrometry
285 Advances in high-resolution MS and hepatocyte models solve a long-standing metabolism challenge: the loratadine story. Bioanalysis. 2016 Aug;8(16):1645-62.
286 #N/A
287 In vitro metabolism of perospirone in rat, monkey and human liver microsomes
288 The wide variability of perospirone metabolism and the effect of perospirone on prolactin in psychiatric patients
289 Antimicrobial Resistance, Virulence Factor-Encoding Genes, and Biofilm-Forming Ability of Community-Associated Uropathogenic Escherichia coli in Western Saudi Arabia
290 Meals, Microbiota and Mental Health in Children and Adolescents (MMM-Study): A protocol for an observational longitudinal case-control study
291 Corrigendum to: Physiologically-based pharmacokinetic modeling to evaluate in vitro-to-in vivo extrapolation for intestinal P-glycoprotein inhibition
292 Transient and resident pathogens: Intra-facility genetic diversity of Listeria monocytogenes and Salmonella from food production environments
293 Insufficient yet improving involvement of the global south in top sustainability science publications
294 A prospective longitudinal study of growth in twin gestations compared with growth in singleton pregnancies. I. The fetal head J Ultrasound Med. 1991 Aug;10(8):439-43. doi: 10.7863/jum.1991.10.8.439.
295 Metabolism of Meloxicam in human liver involves cytochromes P4502C9 and 3A4. Xenobiotica. 1998 Jan;28(1):1-13.
296 Genetic variation in the first-pass metabolism of ethinylestradiol, sex hormone binding globulin levels and venous thrombosis risk Eur J Intern Med. 2017 Jul;42:54-60. doi: 10.1016/j.ejim.2017.05.019.
297 Metabolism of 17 alpha-ethinylestradiol by human liver microsomes in vitro: aromatic hydroxylation and irreversible protein binding of metabolites J Clin Endocrinol Metab. 1974 Dec;39(6):1072-80. doi: 10.1210/jcem-39-6-1072.
298 Metamizole (Dipyrone) and the Liver: A Review of the Literature J Clin Pharmacol. 2019 Nov;59(11):1433-1442. doi: 10.1002/jcph.1512.
299 Clinical pharmacokinetics of dipyrone and its metabolites Clin Pharmacokinet. 1995 Mar;28(3):216-34. doi: 10.2165/00003088-199528030-00004.
300 Effects of cytochrome P450 single nucleotide polymorphisms on methadone metabolism and pharmacodynamics
301 In vitro metabolism of montelukast by cytochrome P450s and UDP-glucuronosyltransferases. Drug Metab Dispos. 2015 Dec;43(12):1905-16.
302 DrugBank(Pharmacology-Metabolism):Adagrasib
303 DrugBank(Pharmacology-Metabolism):Mycophenolate mofetil
304 Identification of human cytochrome P450 isozymes involved in the metabolism of naftopidil enantiomers in vitro. J Pharm Pharmacol. 2014 Nov;66(11):1534-51.
305 Characterization of Ca(2+)-antagonistic effects of three metabolites of the new antihypertensive agent naftopidil, (naphthyl)hydroxy-naftopidil, (phenyl)hydroxy-naftopidil, and O-desmethyl-naftopidil J Cardiovasc Pharmacol. 1991 Dec;18(6):918-25. doi: 10.1097/00005344-199112000-00020.
306 S-Naproxen and desmethylnaproxen glucuronidation by human liver microsomes and recombinant human UDP-glucuronosyltransferases (UGT): role of UGT2B7 in the elimination of naproxen. Br J Clin Pharmacol. 2005 Oct;60(4):423-33.
307 [Pharmacokinetics of phenazone after bilateral ovariectomy in female rabbits]
308 Inhibitory effects of nicardipine to cytochrome P450 (CYP) in human liver microsomes. Biol Pharm Bull. 2005 May;28(5):882-5.
309 Metabolic pro?ling of tyrosine kinase inhibitor nintedanib using metabolomics J Pharm Biomed Anal. 2020 Feb 20;180:113045. doi: 10.1016/j.jpba.2019.113045.
310 DrugBank(Pharmacology-Metabolism)Olodaterol hydrochloride
311 Absorption, Metabolism, and Excretion, In Vitro Pharmacology, and Clinical Pharmacokinetics of Ozanimod, a Novel Sphingosine 1-Phosphate Receptor Modulator
312 Noise in an ac biased junction: Nonstationary Aharonov-Bohm effect Phys Rev Lett. 1994 Jan 24;72(4):538-541. doi: 10.1103/PhysRevLett.72.538.
313 Pazopanib: the newest tyrosine kinase inhibitor for the treatment of advanced or metastatic renal cell carcinoma. Drugs. 2011 Mar 5;71(4):443-54.
314 Bioavailability, metabolism and disposition of oral pazopanib in patients with advanced cancer Xenobiotica. 2013 May;43(5):443-53. doi: 10.3109/00498254.2012.734642.
315 Anti-Parkinson's disease drugs and pharmacogenetic considerations Expert Opin Drug Metab Toxicol. 2013 Jul;9(7):859-74. doi: 10.1517/17425255.2013.789018.
316 DrugBank(Pharmacology-Metabolism)Phenobarbital
317 Simultaneous quantitation of pioglitazone and its metabolites in human serum by liquid chromatography and solid phase extraction J Pharm Biomed Anal. 1996 Feb;14(4):465-73. doi: 10.1016/0731-7085(95)01665-1.
318 Metabolic fate of pitavastatin, a new inhibitor of HMG-CoA reductase: human UDP-glucuronosyltransferase enzymes involved in lactonization. Xenobiotica. 2003 Jan;33(1):27-41.
319 Novel pathways of ponatinib disposition catalyzed by CYP1A1 involving generation of potentially toxic metabolites. J Pharmacol Exp Ther. 2017 Oct;363(1):12-19.
320 Absorption, metabolism, and excretion of [(14)C]ponatinib after a single oral dose in humans Cancer Chemother Pharmacol. 2017 Mar;79(3):507-518. doi: 10.1007/s00280-017-3240-x.
321 In vitro metabolites characterization of ponatinib in human liver microsomes using ultra-high performance liquid chromatography combined with Q-Exactive-Orbitrap tandem mass spectrometry Biomed Chromatogr. 2020 Jun;34(6):e4819. doi: 10.1002/bmc.4819.
322 Different effects of SLCO1B1 polymorphism on the pharmacokinetics and pharmacodynamics of repaglinide and nateglinide
323 Bioanalytical method for in vitro metabolism study of repaglinide using 96-blade thin-film solid-phase microextraction and LC-MS/MS
324 Repaglinide-gemfibrozil drug interaction: inhibition of repaglinide glucuronidation as a potential additional contributing mechanism. Br J Clin Pharmacol. 2010 Dec;70(6):870-80.
325 Simultaneous quantification of rosiglitazone and its two major metabolites, N-desmethyl and p-hydroxy rosiglitazone in human plasma by liquid chromatography/tandem mass spectrometry: application to a pharmacokinetic study
326 Simultaneous Determination of Rosuvastatin, Rosuvastatin-5?S-lactone, and N-desmethyl Rosuvastatin in Human Plasma by UPLC-MS/MS and Its Application to Clinical Study
327 FDA LABEL:elexipag
328 Application of liquid chromatography-electrospray ionization-ion trap mass spectrometry to investigate the metabolism of silibinin in human liver microsomes
329 Metabolism, Transport and Drug-Drug Interactions of Silymarin
330 A comparison of the effects of 3-hydroxy-3-methylglutaryl-coenzyme a (HMG-CoA) reductase inhibitors on the CYP3A4-dependent oxidation of mexazolam in vitro. Drug Metab Dispos. 2001 Mar;29(3):282-8.
331 Metabolism and excretion of the dipeptidyl peptidase 4 inhibitor [14C]sitagliptin in humans
332 Absorption, Distribution, Metabolism, and Excretion of [(14)C]-Sotorasib in Rats and Dogs: Interspecies Differences in Absorption, Protein Conjugation and Metabolism
333 Identification of cytochrome P450 and arylamine N-acetyltransferase isoforms involved in sulfadiazine metabolism. Drug Metab Dispos. 2005 Jul;33(7):969-76.
334 The effect of cimetidine on the formation of sulfamethoxazole hydroxylamine in patients with human immunodeficiency virus. J Clin Pharmacol. 1998 May;38(5):463-6.
335 Clinical pharmacokinetics and drug metabolism of tazarotene: a novel topical treatment for acne and psoriasis Clin Pharmacokinet. 1999 Oct;37(4):273-87. doi: 10.2165/00003088-199937040-00001.
336 LABEL:AZAROTENE aerosol, foam
337 Pharmacokinetics and metabolism of temazepam in man and several animal species Br J Clin Pharmacol. 1979;8(1):23S-29S. doi: 10.1111/j.1365-2125.1979.tb00451.x.
338 Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66.
339 Temsirolimus metabolic pathways revisited Xenobiotica. 2020 Jun;50(6):640-653. doi: 10.1080/00498254.2019.1678793.
340 Multiple cytochrome P-450s involved in the metabolism of terbinafine suggest a limited potential for drug-drug interactions. Drug Metab Dispos. 1999 Sep;27(9):1029-38.
341 A multi-residue chiral liquid chromatography coupled with tandem mass spectrometry method for analysis of antifungal agents and their metabolites in aqueous environmental matrices. Anal Methods. 2021 Jun 14;13(22):2466-2477. doi: 10.1039/d1ay00556a.
342 Simultaneous determination of torasemide and its major metabolite M5 in human urine by high-performance liquid chromatography-electrochemical detection
343 Retinoic acid metabolism and mechanism of action: a review
344 LABEL:KLIEF- trifarotene cream
345 Oxidation of troglitazone to a quinone-type metabolite catalyzed by cytochrome P-450 2C8 and P-450 3A4 in human liver microsomes. Drug Metab Dispos. 1999 Nov;27(11):1260-6.
346 Intestinal motility and its disorders Scand J Urol Nephrol Suppl. 1992;142:18-21.
347 A simple and sensitive HPLC-FL method for bioanalysis of velpatasvir, a novel hepatitis C virus NS5A inhibitor, in rat plasma: Investigation of factors determining its oral bioavailability J Chromatogr B Analyt Technol Biomed Life Sci. 2022 Oct 1;1208:123399. doi: 10.1016/j.jchromb.2022.123399.
348 Vortioxetine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2018 Jun;57(6):673-686.
349 Comparative pharmacokinetics of vitamin K antagonists: warfarin, phenprocoumon and acenocoumarol. Clin Pharmacokinet. 2005;44(12):1227-46.
350 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
351 Metabolism and pharmacokinetics of the combination Zidovudine plus Lamivudine in the adult Erythrocebus patas monkey determined by liquid chromatography-tandem mass spectrometric analysis
352 Distribution of zopiclone and main metabolites in hair following a single dose

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.