Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0003)
DME Name	Cytochrome P450 1A2 (CYP1A2), Homo sapiens
Synonyms	Cytochrome P450 family 1 subfamily A member 2; Cytochrome P450 4; Cytochrome P450-P3; Cytochrome P(3)450; CYP1A2; CYPIA2
Gene Name	CYP1A2
UniProt ID	CP1A2_HUMAN
Gene ID	1544
EC Number	EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) Oxidoreductase Oxygen paired donor oxidoreductase Flavin/flavoprotein donor oxidoreductase EC: 1.14.14.1
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Microbiome and DME (MICBIO) Jump to Detailed Interactome Data
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
Structure	2HI4
Pathway	Caffeine metabolism (hsa00232 )
	Chemical carcinogenesis (hsa05204 )
	Drug metabolism - cytochrome P450 (hsa00982 )
	Linoleic acid metabolism (hsa00591 )
	Metabolic pathways (hsa01100 )
	Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
	Retinol metabolism (hsa00830 )
	Steroid hormone biosynthesis (hsa00140 )
	Tryptophan metabolism (hsa00380 )
Function	This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. It catalyzes the hydroxylation of carbon-hydrogen bonds and exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta- estradiol (E2), namely 2-hydroxy E1 and E2. It metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. It also plays a role in the oxidative metabolism of xenobiotics and catalyzes the N-hydroxylation of heterocyclic amines and the O-deethylation of phenacetin. Specificlly, it metabolizes caffeine via N3-demethylation.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 210 Drugs
Thalidomide	Drug Info	Approved	Breast cancer	ICD11: 2C60	[1], [2]
Tamoxifen citrate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[3]
Erlotinib hydrochloride	Drug Info	Approved	Lung cancer	ICD11: 2C25	[4]
Alosetron hydrochloride	Drug Info	Approved	Irritable bowel syndrome	ICD11: DD91	[5]
Idelalisib	Drug Info	Approved	Chronic lymphocytic leukaemia	ICD11: 2A82	[6]
Warfarin sodium	Drug Info	Approved	Atrial fibrillation	ICD11: BC81	[7]
Estradiol acetate	Drug Info	Approved	Acquired prion disease	ICD11: 8E01	[8]
Estradiol cypionate	Drug Info	Approved	Acquired prion disease	ICD11: 8E01	[9]
Estradiol valerate	Drug Info	Approved	Acquired prion disease	ICD11: 8E01	[9]
Estrone	Drug Info	Approved	Menopausal disorder	ICD11: GA30	[10]
Nicotine	Drug Info	Approved	Nicotine dependence	ICD11: 6C4A	[11]
Apremilast	Drug Info	Approved	Psoriasis vulgaris	ICD11: EA90	[12]
Nabumetone	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[13]
Bortezomib	Drug Info	Approved	Breast cancer	ICD11: 2C60	[14]
Diclofenac sodium	Drug Info	Approved	Osteoarthritis	ICD11: FA00	[15]
Fospropofol disodium	Drug Info	Approved	Monitored anaesthesia care	ICD11: N.A.	[16]
Metoclopramide hydrochloride	Drug Info	Approved	Functional nausea/vomiting	ICD11: DD90	[17]
Primaquine	Drug Info	Approved	Malaria	ICD11: 1F40	[18]
Almogran	Drug Info	Approved	Migraine	ICD11: 8A80	[19]
Imatinib mesylate	Drug Info	Approved	Chronic myelogenous leukaemia	ICD11: 2A20	[20]
Lidocaine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[21]
Cannabidiol	Drug Info	Approved	Lennox-Gastaut syndrome	ICD11: 8A62	[22]
Capsaicin	Drug Info	Approved	Herpes zoster	ICD11: 1E91	[23]
Clomipramine hydrochloride	Drug Info	Approved	Obsessive-compulsive disorder	ICD11: 6B20	[24]
Lapatinib ditosylate	Drug Info	Approved	Breast cancer	ICD11: 2C60	[4]
Sunitinib malate	Drug Info	Approved	Renal cell carcinoma	ICD11: 2C90	[]
Sunitinib malate	Drug Info	Approved	Renal cell carcinoma	ICD11: 2C90	[25]
Terbinafine hydrochloride	Drug Info	Approved	Pityriasis versicolor	ICD11: 1F2D	[26]
Almotriptan malate	Drug Info	Approved	Migraine	ICD11: 8A80	[27]
Aprepitant	Drug Info	Approved	Functional nausea/vomiting	ICD11: DD90	[28]
Asenapine maleate	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[29]
Betaxolol	Drug Info	Approved	Essential hypertension	ICD11: BA00	[30]
Clomipramine	Drug Info	Approved	Depression	ICD11: 6A70-6A7Z	[31]
Clomipramine	Drug Info	Approved	Depression	ICD11: 6A70-6A7Z	[24], [32]
Conjugated estrogens	Drug Info	Approved	Menopausal disorder	ICD11: GA30	[33]
Cyclobenzaprine	Drug Info	Approved	Depression	ICD11: 6A71	[34]
Daunorubicin	Drug Info	Approved	Acute myeloid leukaemia	ICD11: 2A60	[35]
Duloxetine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[36]
Febuxostat	Drug Info	Approved	Hyperuricaemia	ICD11: 5C55	[37]
Ixazomib	Drug Info	Approved	Amyloidosis	ICD11: 5D00	[38]
Tacrine hydrochloride	Drug Info	Approved	Alzheimer disease	ICD11: 8A20	[21]
Albendazole	Drug Info	Approved	Giardiasis	ICD11: 1A31	[39]
Dopamine hydrochloride	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[40]
Fluvoxamine maleate	Drug Info	Approved	Obsessive-compulsive disorder	ICD11: 6B20	[41]
Osimertinib	Drug Info	Approved	Lung cancer	ICD11: 2C25	[42]
Pentoxifylline	Drug Info	Approved	Arteriosclerosis obliterans	ICD11: BD40	[43]
Perampanel	Drug Info	Approved	Focal seizure	ICD11: 8A68	[44]
Quinine sulfate	Drug Info	Approved	Malaria	ICD11: 1F40	[45]
Alitretinoin	Drug Info	Approved	Kaposi sarcoma	ICD11: 2B57	[46]
Axitinib	Drug Info	Approved	Renal cell carcinoma	ICD11: 2C90	[47]
Caffeine	Drug Info	Approved	Orthostatic hypotension	ICD11: BA21	[1]
Carvedilol	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[48]
Deutetrabenazine	Drug Info	Approved	Huntington disease	ICD11: 8A01	[49]
Diazepam	Drug Info	Approved	Epilepsy	ICD11: 8A60	[50]
Doxepin hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[51]
Flutamide	Drug Info	Approved	Prostate cancer	ICD11: 2C82	[52]
Haloperidol decanoate	Drug Info	Approved	Agitation/aggression	ICD11: 6D86	[53]
Levonorgestrel	Drug Info	Approved	Menorrhagia	ICD11: GA20	[54]
Lorcaserin	Drug Info	Approved	Obesity	ICD11: 5B81	[55]
Naproxen	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[56]
Norethindrone acetate	Drug Info	Approved	Menorrhagia	ICD11: GA20	[57]
Norfloxacin	Drug Info	Approved	Infectious cystitis	ICD11: GC00	[58]
Ondansetron	Drug Info	Approved	Gastritis	ICD11: DA42	[59]
Pomalidomide	Drug Info	Approved	Breast cancer	ICD11: 2C60	[60]
Propafenone hydrochloride	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[61]
Propranolol hydrochloride	Drug Info	Approved	Migraine	ICD11: 8A80	[21]
Rofecoxib	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[62]
Tocainide	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[63]
Trimethoprim	Drug Info	Approved	Infectious cystitis	ICD11: GC00	[64]
Verapamil hydrochloride	Drug Info	Approved	Essential hypertension	ICD11: BA00	[65]
Amitriptyline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[66]
Bromfenac	Drug Info	Approved	Cataract	ICD11: 9B10	[67]
Carbamazepine	Drug Info	Approved	Epilepsy	ICD11: 8A60	[68]
Cinacalcet hydrochloride	Drug Info	Approved	Hyperparathyroidism	ICD11: 5A51	[69]
Dasatinib	Drug Info	Approved	Chronic myelogenous leukaemia	ICD11: 2A20	[4]
Dexmedetomidine hydrochloride	Drug Info	Approved	Tension headache	ICD11: 8A81	[70]
Efavirenz	Drug Info	Approved	Human immunodeficiency virus infection	ICD11: 1C60	[71]
Exjade	Drug Info	Approved	Hyperphosphatemia	ICD11: 5C64	[72]
Fluoxetine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[58]
Imipramine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[73]
Indomethacin	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[74]
Istradefylline	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[75]
Leflunomide	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[21]
Levomepromazine	Drug Info	Approved	Insomnia	ICD11: 7A00	[76]
Olanzapine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[77]
Phenytoin	Drug Info	Approved	Epilepsy	ICD11: 8A60	[78]
Promazine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[78]
Riluzole	Drug Info	Approved	Amyotrophic lateral sclerosis	ICD11: 8B60	[79]
Ropivacaine hydrochloride	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[80]
Rucaparib	Drug Info	Approved	Ovarian cancer	ICD11: 2C73	[81]
Zileuton	Drug Info	Approved	Asthma	ICD11: CA23	[21]
Zolpidem tartrate	Drug Info	Approved	Insomnia	ICD11: 7A00	[82]
Amiodarone hydrochloride	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[83]
Amoxapine	Drug Info	Approved	Depression	ICD11: 6A71	[84]
Azathioprine	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[85]
Azelastine	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[86]
Bendamustine	Drug Info	Approved	Chronic lymphocytic leukaemia	ICD11: 2A82	[87]
Chlorpromazine hydrochloride	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[88]
Clofazimine	Drug Info	Approved	Crohn disease	ICD11: DD70	[89]
Clonidine	Drug Info	Approved	Essential hypertension	ICD11: BA00	[90]
Clozapine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[91]
Diphenhydramine	Drug Info	Approved	Meniere disease	ICD11: AB31	[92]
Ethosuximide	Drug Info	Approved	Epilepsy	ICD11: 8A60	[93]
Exemestane	Drug Info	Approved	Breast cancer	ICD11: 2C60	[94]
Frovatriptan	Drug Info	Approved	Migraine	ICD11: 8A80	[95]
Levobupivacaine	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[96]
Loxapine succinate	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[97]
Malathion	Drug Info	Approved	Pediculosis	ICD11: 1G00	[98]
Mirtazapine	Drug Info	Approved	Depression	ICD11: 6A71	[99]
Paroxetine hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[100]
Pazopanib	Drug Info	Approved	Renal cell carcinoma	ICD11: 2C90	[101]
Perphenazine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[102]
Pimozide	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[103]
Ponatinib hydrochloride	Drug Info	Approved	Acute lymphoblastic leukemia	ICD11: 2B33	[104]
Pralsetinib	Drug Info	Approved	Lung cancer	ICD11: 2C25	[105]
Pralsetinib	Drug Info	Approved	Lung cancer	ICD11: 2C25	[106]
Propofol	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[107]
Ropinirole hydrochloride	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[108]
Sumatriptan	Drug Info	Approved	Migraine	ICD11: 8A80	[109]
Tasimelteon	Drug Info	Approved	Insomnia	ICD11: 7A00	[110]
Theophylline	Drug Info	Approved	Chronic obstructive pulmonary disease	ICD11: CA22	[111]
Thiabendazole	Drug Info	Approved	Aspergillosis	ICD11: 1F20	[21]
Thioridazine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[112]
Triclosan	Drug Info	Approved	Malaria	ICD11: 1F40-1F45	[113]
Acetaminophen	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[114]
Apixaban	Drug Info	Approved	Deep vein thrombosis	ICD11: BD71	[115]
Benzocaine	Drug Info	Approved	Anaesthesia	ICD11: 9A76-9A78	[116]
Binimetinib	Drug Info	Approved	Melanoma	ICD11: 2C30	[117]
Ciprofloxacin	Drug Info	Approved	Endocarditis	ICD11: 1B12	[118]
Dapagliflozin	Drug Info	Approved	Diabetes mellitus	ICD11: 5A10	[119]
Etoposide	Drug Info	Approved	Lung cancer	ICD11: 2C25	[120]
Fluorouracilo	Drug Info	Approved	Stomach cancer	ICD11: 2B72	[121]
Gefitinib	Drug Info	Approved	Lung cancer	ICD11: 2C25	[122]
Grepafloxacin	Drug Info	Approved	Bronchitis	ICD11: CA20	[123]
Griseofulvin	Drug Info	Approved	Dermatophytosis	ICD11: 1F28	[124]
Lenvatinib	Drug Info	Approved	Thyroid cancer	ICD11: 2D10	[125]
Levomethadyl acetate hydrochloride	Drug Info	Approved	Opiate dependence	ICD11: 6C43	[126]
Maprotiline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[127]
Methadone	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[128]
Methyldopa	Drug Info	Approved	Essential hypertension	ICD11: BA00	[129]
Mexiletine hydrochloride	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[130]
Midodrine	Drug Info	Approved	Orthostatic hypotension	ICD11: BA21	[131]
Olopatadine	Drug Info	Approved	Conjunctivitis	ICD11: 9A60	[132]
Oxtriphylline	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[133]
Pantoprazole sodium	Drug Info	Approved	Gastro-oesophageal reflux disease	ICD11: DA22	[134]
Pirfenidone	Drug Info	Approved	Acute kidney failure	ICD11: GB60	[135]
Procarbazine	Drug Info	Approved	Anaplastic large cell lymphoma	ICD11: 2A90	[136]
Ranitidine	Drug Info	Approved	Peptic ulcer	ICD11: DA61	[137]
Rasagiline mesylate	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[138]
Sorafenib	Drug Info	Approved	Renal cell carcinoma	ICD11: 2C90	[139]
Tapinarof	Drug Info	Approved	Discovery agent	ICD: N.A.	[140]
Timolol maleate	Drug Info	Approved	Essential hypertension	ICD11: BA00	[141]
Azilsartan	Drug Info	Approved	Hypertension	ICD11: BA00-BA04	[142], [143]
Cilostazol	Drug Info	Approved	Arteriosclerosis obliterans	ICD11: BD40	[69]
Clofibrate	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[144]
Clopidogrel bisulfate	Drug Info	Approved	Acute coronary syndrome	ICD11: BA4Z	[145]
Eltrombopag olamine	Drug Info	Approved	Thrombocytopenia	ICD11: 3B64	[146]
Ergotamine tartrate	Drug Info	Approved	Migraine	ICD11: 8A80	[95]
Flecainide acetate	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[147]
Flibanserin	Drug Info	Approved	Inhibited sexual desire	ICD11: HA00	[148]
Fluvoxamine	Drug Info	Approved	Depression	ICD11: 6A70-6A7Z	[149]
Granisetron hydrochloride	Drug Info	Approved	Functional nausea/vomiting	ICD11: DD90	[150]
Lomitapide mesylate	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[151]
Loratadine	Drug Info	Approved	Allergic rhinitis	ICD11: CA08	[152]
Mephenytoin	Drug Info	Approved	Epilepsy	ICD11: 8A60	[153]
Nifedipine	Drug Info	Approved	Angina pectoris	ICD11: BA40	[154]
Oxaliplatin	Drug Info	Approved	Colorectal cancer	ICD11: 2B91	[155]
Pefloxacin	Drug Info	Approved	Gonococcal urethritis	ICD11: 1A70-1A7Z	[156]
Pentamidine isethionate	Drug Info	Approved	Pneumocystis pneumonia	ICD11: CA40	[18]
Pyrazinamide	Drug Info	Approved	Pulmonary tuberculosis	ICD11: 1B10	[157]
Selegiline	Drug Info	Approved	Major depressive disorder	ICD11: 6A70-6A7Z	[158]
Selegiline hydrochloride	Drug Info	Approved	Parkinsonism	ICD11: 8A00	[158]
Sertraline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[159]
Stiripentol	Drug Info	Approved	Epilepsy	ICD11: 8A60	[160]
Sulindac	Drug Info	Approved	Rheumatoid arthritis	ICD11: FA20	[161]
Tizanidine hydrochloride	Drug Info	Approved	Muscle spasticity	ICD11: FB30	[21]
Triclabendazole	Drug Info	Approved	Fascioliasis	ICD11: 1F82	[162]
Ulipristal	Drug Info	Approved	Contraception	ICD11: JA65	[163]
Zolmitriptan	Drug Info	Approved	Migraine	ICD11: 8A80	[50]
Anagrelide hydrochloride	Drug Info	Approved	Thrombocytosis	ICD11: 3B63	[164]
Benzyl alcohol	Drug Info	Approved	Pediculosis	ICD11: 1G00	[165]
Carmustine	Drug Info	Approved	Hepatocellular carcinoma	ICD11: 2C12	[166]
Chloroquine	Drug Info	Approved	Malaria	ICD11: 1F40	[167]
Chlorzoxazone	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[168]
Dacarbazine	Drug Info	Approved	Melanoma	ICD11: 2C30	[169]
Desipramine	Drug Info	Approved	Attention deficit hyperactivity disorder	ICD11: 6A05	[134]
Dinoprostone	Drug Info	Approved	Abortion	ICD11: JA00	[170]
Disopyramide phosphate	Drug Info	Approved	Ventricular tachyarrhythmia	ICD11: BC71	[171]
Enasidenib	Drug Info	Approved	Acute myeloid leukaemia	ICD11: 2A60	[172]
Erythromycin stearate	Drug Info	Approved	Acute upper respiratory infection	ICD11: CA07	[173]
Guanabenz	Drug Info	Approved	Hypertriglyceridaemia	ICD11: 5C80	[21]
Imiquimod	Drug Info	Approved	Basal cell carcinoma	ICD11: 2C32	[134]
Lomefloxacin	Drug Info	Approved	Conjunctivitis	ICD11: 9A60	[174]
Nortriptyline hydrochloride	Drug Info	Approved	Depression	ICD11: 6A71	[175]
Praziquantel	Drug Info	Approved	Schistosomiasis	ICD11: 1F86	[18]
Rifampicin	Drug Info	Approved	Osteoporosis	ICD11: FB83	[176]
Roflumilast	Drug Info	Approved	Chronic obstructive pulmonary disease	ICD11: CA22	[177]
Sevoflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[178]
Triamterene	Drug Info	Approved	Congestive heart failure	ICD11: BD10	[179]
Voxilaprevir	Drug Info	Approved	Viral hepatitis	ICD11: 1E51	[180]
Voxilaprevir	Drug Info	Approved	Viral hepatitis	ICD11: 1E51	[181]
Aminophylline	Drug Info	Approved	Asthma	ICD11: CA23	[182]
Menadione	Drug Info	Approved	Vitamin deficiency	ICD11: 5B55	[183]
Methoxyflurane	Drug Info	Approved	Anaesthesia	ICD11: 8E22	[184]
Ramelteon	Drug Info	Approved	Insomnia	ICD11: 7A00	[185]
Thiothixene	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[186]
Trifluoperazine	Drug Info	Approved	Schizophrenia	ICD11: 6A20	[187]
Umbralisib	Drug Info	Approved	Follicular lymphoma	ICD11: 2A80	[188]
Berberine	Drug Info	Phase 4	Discovery agent	ICD: N.A.	[190]
Neupro	Drug Info	Phase 4	Restless legs syndrome	ICD11: 7A80	[194]
Drugs in Phase 4 Clinical Trial			Click to Show/Hide the Full List of Drugs: 23 Drugs
Lumiracoxib	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[189]
Ethinylestradiol propanesulfonate	Drug Info	Phase 4	Prostate cancer	ICD11: 2C82	[191], [192]
Cinnarizine	Drug Info	Phase 4	Haemorrhagic stroke	ICD11: 8B20	[193]
Melatonin	Drug Info	Phase 4	Foetal growth restriction	ICD11: KA20	[195]
Mianserin	Drug Info	Phase 4	Depression	ICD11: 6A71	[196]
Zotepine	Drug Info	Phase 4	Schizophrenia	ICD11: 6A20	[197]
Dexfenfluramine	Drug Info	Phase 4	Obesity	ICD11: 5B81	[198]
Etoricoxib	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[199]
Idebenone	Drug Info	Phase 4	Mitochondrial myopathy	ICD11: 8C73	[200]
Phenacetin	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[201]
Aminophenazone	Drug Info	Phase 4	Anaesthesia	ICD11: 8E22	[134]
Dihydralazine	Drug Info	Phase 4	Essential hypertension	ICD11: BA00	[202]
Flunarizine	Drug Info	Phase 4	Schizophrenia	ICD11: 6A20	[144]
Flunitrazepam	Drug Info	Phase 4	Insomnia	ICD11: 7A00	[134]
Perazine	Drug Info	Phase 4	Cerebrovascular dementia	ICD11: 6D81	[203]
Temafloxacin	Drug Info	Phase 4	Acute lower respiratory infection	ICD11: CA4Z	[174]
Agomelatine	Drug Info	Phase 4	Depression	ICD11: 6A71	[204]
Lofexidine	Drug Info	Phase 4	Opiate dependence	ICD11: 6C43	[205]
Proguanil	Drug Info	Phase 4	Malaria	ICD11: 1F40	[153]
Ramosetron	Drug Info	Phase 4	Irritable bowel syndrome	ICD11: DD91	[206]
Doxofylline	Drug Info	Phase 4	Chronic obstructive pulmonary disease	ICD11: CA22	[207]
Tegafur	Drug Info	Phase 4	Colon cancer	ICD11: 2B90	[134]
Pentifylline	Drug Info	Phase 4	Cerebrovascular dementia	ICD11: 6D81	[207]
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 22 Drugs
Fidarestat	Drug Info	Phase 3	Diabetic complication	ICD11: 5A2Y	[208]
E-3A	Drug Info	Phase 3	Turner syndrome	ICD11: LD50	[209]
Selumetinib	Drug Info	Phase 3	Neurofibromatosis	ICD11: LD2D	[210], [211]
BPI-2009	Drug Info	Phase 3	Lung cancer	ICD11: 2C25	[212]
Chlorpromazine	Drug Info	Phase 3	Coronavirus Disease 2019 (COVID-19)	ICD11: 1D6Y	[213]
DOV-220075	Drug Info	Phase 3	Depression	ICD11: 6A71	[214]
KW-5338	Drug Info	Phase 3	Gastroparesis	ICD11: DA41	[215]
NSC-122758	Drug Info	Phase 3	Vitamin deficiency	ICD11: 5B55	[216]
Maribavir	Drug Info	Phase 3	Cytomegalovirus infection	ICD11: 1D82	[217]
SB-939	Drug Info	Phase 3	Acute myeloid leukaemia	ICD11: 2A60	[218]
BMS-986165	Drug Info	Phase 3	Psoriasis vulgaris	ICD11: EA90	[219]
Brivanib	Drug Info	Phase 3	Breast cancer	ICD11: 2C60-2C6Y	[220]
HSDB-3466	Drug Info	Phase 3	Psoriasis vulgaris	ICD11: EA90	[221]
SC-15090	Drug Info	Phase 3	Acute bronchitis	ICD11: CA42	[222]
LY-450139	Drug Info	Phase 3	Alzheimer disease	ICD11: 8A20	[223]
SRT-501	Drug Info	Phase 3	Nephroptosis	ICD11: GB90	[224]
Fenfluramine	Drug Info	Phase 3	Dravet syndrome	ICD11: 8A61-8A6Z	[225]
MRTX849	Drug Info	Phase 3	Lung cancer	ICD11: 2C25	[226]
SHP-620	Drug Info	Phase 3	Cytomegalovirus infection	ICD11: 1D82	[217]
Ag-221	Drug Info	Phase 3	Acute myelogenous leukaemia	ICD11: 2A41	[227]
CYT-387	Drug Info	Phase 3	Myelofibrosis	ICD11: 2A22	[228]
PNU-95666	Drug Info	Phase 3	Parkinsonism	ICD11: 8A00	[229]
Drugs in Phase 2 Clinical Trial			Click to Show/Hide the Full List of Drugs: 35 Drugs
Verapamil	Drug Info	Phase 2/3	Hypertension	ICD11: BA00-BA04	[230]
EMD-128130	Drug Info	Phase 2/3	Rett syndrome	ICD11: LD90	[231]
Fexinidazole	Drug Info	Phase 2/3	Trypanosomiasis	ICD11: 1D51-1F53	[232], [233]
Fexinidazole	Drug Info	Phase 2/3	Trypanosomiasis	ICD11: 1D51-1F53	[233]
HOE-239	Drug Info	Phase 2/3	Trypanosomiasis	ICD11: 1F51	[233]
Leniolisib	Drug Info	Phase 2	Sjogren syndrome	ICD11: 4A43	[234]
BIO-300	Drug Info	Phase 2	Prostate cancer	ICD11: 2C82	[235]
NITD609	Drug Info	Phase 2	Malaria	ICD11: 1F40-1F45	[236]
Ethanol	Drug Info	Phase 2	Diabetic nephropathy	ICD11: GB61	[134]
ANW-60941	Drug Info	Phase 2	Uterine cancer	ICD11: 2C76	[237]
PT2385	Drug Info	Phase 2	Von hippel-lindau disease	ICD11: 5A75	[238]
VATALANIB	Drug Info	Phase 2	Solid tumour/cancer	ICD11: 2A00-2F9Z	[239]
VATALANIB	Drug Info	Phase 2	Solid tumour/cancer	ICD11: 2A00-2F9Z	[240]
BCP-13498	Drug Info	Phase 2	Anaesthesia	ICD11: 8E22	[241]
Triapine	Drug Info	Phase 2	Nerve injury	ICD11: ND56	[242]
HP-184	Drug Info	Phase 2	Multiple sclerosis	ICD11: 8A40	[243]
Saracatinib	Drug Info	Phase 2	Osteosarcoma	ICD11: 2B51	[244]
AV-650	Drug Info	Phase 2	Cerebral vasospasm	ICD11: BA85	[245]
BMS-911543	Drug Info	Phase 2	Chronic myelogenous leukaemia	ICD11: 2A20	[246]
Ladostigil	Drug Info	Phase 2	Alzheimer disease	ICD11: 8A20	[247]
PD-115934	Drug Info	Phase 2	Breast cancer	ICD11: 2C60	[157]
Vincamine	Drug Info	Phase 2	Cerebrovascular dementia	ICD11: 6D81	[248]
AR-67	Drug Info	Phase 2	Brain cancer	ICD11: 2A00	[249]
ASA-404	Drug Info	Phase 2	Prostate cancer	ICD11: 2C82	[250]
CT-1501R	Drug Info	Phase 2	Diabetes mellitus	ICD11: 5A10	[251]
GTS-21	Drug Info	Phase 2	Schizophrenia	ICD11: 6A20	[252]
NAB-365	Drug Info	Phase 2	Amyotrophic lateral sclerosis	ICD11: 8B60	[253]
SMT-C1100	Drug Info	Phase 2	Muscular dystrophy	ICD11: 8C70	[254]
Verubulin	Drug Info	Phase 2	Brain cancer	ICD11: 2A00	[255]
AZD4635	Drug Info	Phase 2	Prostate cancer	ICD11: 2C82	[256]
TAK-906	Drug Info	Phase 2	Gastroparesis	ICD11: DA41	[257]
Encequidar	Drug Info	Phase 2	Metastatic breast cancer	ICD11: 2C60-2C6Y	[258]
GS-9857	Drug Info	Phase 2	Hepatitis C virus infection	ICD11: 1E50-1E51	[259]
N-DESMETHYLCLOZAPINE	Drug Info	Phase 2	Schizophrenia	ICD11: 6A20	[260]
SHR-1020	Drug Info	Phase 2	Breast cancer	ICD11: 2C60	[261]
Drugs in Phase 1 Clinical Trial			Click to Show/Hide the Full List of Drugs: 16 Drugs
CB-3304	Drug Info	Phase 1/2	Chronic lymphocytic leukaemia	ICD11: 2A82	[262]
PIPERINE	Drug Info	Phase 1/2	Vitiligo	ICD11: ED63	[263]
CCRIS-1920	Drug Info	Phase 1/2	Osteoporosis	ICD11: FB83	[264]
SB-1317	Drug Info	Phase 1/2	Brain cancer	ICD11: 2A00	[265]
AST-1306	Drug Info	Phase 1	Solid tumour/cancer	ICD11: 2A00-2F9Z	[266]
BE-14348A	Drug Info	Phase 1	Viral hepatitis	ICD11: 1E51	[267]
Daniquidone	Drug Info	Phase 1	Lymphoma	ICD11: 2A80-2A86	[268]
H3B-6545	Drug Info	Phase 1	Breast cancer	ICD11: 2C60	[269]
Alvespimycin hydrochloride	Drug Info	Phase 1	Ovarian cancer	ICD11: 2C73	[270]
Xanthine	Drug Info	Phase 1	Obstructive sleep apnea	ICD11: 7A41	[271]
NSC-38348	Drug Info	Phase 1	Asthma	ICD11: CA23	[207]
MLN-8054	Drug Info	Phase 1	Colon cancer	ICD11: 2B90	[272]
BAX-2793Z	Drug Info	Phase 1	Asthma	ICD11: CA23	[207]
HWA-285	Drug Info	Phase 1	Cerebrovascular dementia	ICD11: 6D81	[207]
CC-122	Drug Info	Phase 1	Chronic lymphocytic leukaemia	ICD11: 2A82	[273]
G-23350	Drug Info	Phase 1	Venous thromboembolism	ICD11: BD72	[1]
Discontinued/withdrawn Drugs			Click to Show/Hide the Full List of Drugs: 13 Drugs
Cilomilast	Drug Info	Discontinued in Phase 3	Emphysema	ICD11: CA21	[274]
Almokalant	Drug Info	Discontinued in Phase 3	Cardiac arrhythmias	ICD11: BC9Z	[275]
Tetramethylpyrazine	Drug Info	Discontinued in Phase 2	Neurological disorder	ICD11: 6B60	[276]
YM-992	Drug Info	Discontinued in Phase 2	Depression	ICD11: 6A70-6A7Z	[277]
BMS-181168	Drug Info	Discontinued in Phase 2	Cognitive impairment	ICD11: 6D71	[278]
ABT-107	Drug Info	Discontinued in Phase 1	Attention deficit hyperactivity disorder	ICD11: 6A05	[279]
YM-17E	Drug Info	Discontinued in Phase 1	Hypertriglyceridaemia	ICD11: 5C80	[280]
CAM-2028	Drug Info	Discontinued	Acute nasopharyngitis	ICD11: CA00	[134]
Nomifensine	Drug Info	Discontinued	Depression	ICD11: 6A71	[281]
NSC-149027	Drug Info	Discontinued	Herpes simplex virus infection	ICD11: 1F00	[282]
RO-408757	Drug Info	Discontinued	Breast cancer	ICD11: 2C60	[283]
AN-16649	Drug Info	Discontinued	Acute lymphoblastic leukemia	ICD11: 2B33	[284], [285], [286]
INN-00835	Drug Info	Discontinued	Depression	ICD11: 6A71	[287]
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 22 Drugs
EPX-100	Drug Info	Preclinical	Dravet syndrome	ICD11: 8A61	[288]
VA-10872	Drug Info	Preclinical	Anaesthesia	ICD11: 8E22	[289]
Coumarin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[290]
Guajazulen	Drug Info	Investigative	Allergy	ICD11: 4A80	[291]
Nitrobenzanthrone	Drug Info	Investigative	Discovery agent	ICD: N.A.	[292]
Flavone	Drug Info	Investigative	Colon cancer	ICD11: 2B90	[293]
Bufuralol	Drug Info	Investigative	Cardiac arrhythmia	ICD11: BC65	[294]
Bromazepam	Drug Info	Investigative	Anxiety disorder	ICD11: 6B00	[295]
Fenethylline	Drug Info	Investigative	Narcolepsy	ICD11: 7A20	[207]
Antipyrine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[1]
Beta-ionone	Drug Info	Investigative	Breast cancer	ICD11: 2C60	[296]
Estrone sulfate	Drug Info	Investigative	Discovery agent	ICD: N.A.	[297]
Hesperetin	Drug Info	Investigative	Discovery agent	ICD: N.A.	[298]
Imipramine oxide	Drug Info	Investigative	Depression	ICD11: 6A71	[299]
Lauric acid	Drug Info	Investigative	Alzheimer disease	ICD11: 8A20	[300]
Acriflavinium chloride	Drug Info	Investigative	Trypanosomiasis	ICD11: 1F51	[301]
Cyamemazine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[302]
Paraoxon	Drug Info	Investigative	Discovery agent	ICD: N.A.	[303]
Hypoxanthine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[271]
O-Benzylguanine	Drug Info	Investigative	Discovery agent	ICD: N.A.	[304]
Acefylline	Drug Info	Investigative	Discovery agent	ICD: N.A.	[207]
NSC-6113	Drug Info	Investigative	Discovery agent	ICD: N.A.	[305]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR011470	ABT-107	ABT-107 Metabolite M2	Unclear - Unclear	ABT-107	[279]
MR000050	Acetaminophen	NAPQI	Oxidation - Oxidation	Acetaminophen	[306], [307]
MR002988	Alitretinoin	4-oxo-9-cis-retinoic acid	Unclear - Unclear	Alitretinoin	[46]
MR002991	Alitretinoin	4-hydroxy-9-cis-retinoic acid	Unclear - Unclear	Alitretinoin	[46]
MR008995	Almogran	N-desmethylalmotriptan	Oxidation - N-demethylation	Almogran	[19]
MR009416	Almokalant	Almokalant Metabolite M13	Oxidation - Sulfoxidation	Almokalant	[275]
MR000155	Almotriptan malate	LAS 31612	Oxidation - N-Demethylation	Almotriptan malate	[308], [309]
MR000170	Aminophenazone	N-Desmethylaminopyrine	Oxidation - N-Dealkylation	Aminophenazone	[1]
MR000169	Aminophenazone	4-(Dimethylamino)-5-methyl-2-phenyl-1,2-dihydro-3H-pyrazol-3-one	Oxidation - N-Dealkylation	Aminophenazone	[310]
MR000206	Amoxapine	8-hydroxyamoxapine	Oxidation - Hydroxylation	Amoxapine	[311], [312]
MR004542	AN-16649	AQ4	Unclear - Unclear	AN-16649	[284], [285], [286]
MR000234	6,7-dichloro-3-hydroxy-1,5 dihydro-imidazo[2,1-b]quinazolin-2-one	2-amino-5,6-dichloro-3,4,-dihydroquinazoline	Unclear - Unclear	Anagrelide hydrochloride	[313]
MR000235	Anagrelide hydrochloride	6,7-dichloro-3-hydroxy-1,5 dihydro-imidazo[2,1-b]quinazolin-2-one	Oxidation - 3-Hydroxylation	Anagrelide hydrochloride	[314]
MR007486	Antipyrine	Norantipyrine	Unclear - Unclear	Antipyrine	[1]
MR007488	Antipyrine	3-OH-methylantipyrine	Oxidation - Hydrolyzationn	Antipyrine	[1]
MR007487	Antipyrine	4-OH-antipyrine	Oxidation - Hydrolyzationn	Antipyrine	[1]
MR000248	Apixaban	Apixaban M2 metabolite	Oxidation - O-Demethylation	Apixaban	[115], [315]
MR000249	Apixaban	Apixaban M4/7 metabolite	Oxidation - Hydroxylation	Apixaban	[115], [315]
MR000276	Apremilast	O-desmethyl Apremilast	Oxidation - O-Demethylation	Apremilast	[316]
MR002970	Aprepitant	5-({[(1R)-1-(4-fluorophenyl)-2-hydroxyethyl]amino}methyl)-2,3-dihydro-1H-1,2,4-triazol-3-one	Oxidation - O-Dealkylation	Aprepitant	[28], [317]
MR002971	Aprepitant	(2R)-2-(4-fluorophenyl)-2-{[(5-oxo-2,5-dihydro-1H-1,2,4-triazol-3-yl)methyl]amino}acetic acid	Oxidation - O-Dealkylation	Aprepitant	[28], [317]
MR002969	Aprepitant	(2R,3S)-2-[(1R)-1-[3,5-bis(trifluoromethyl)phenyl]ethoxy]-3-(4-fluorophenyl)morpholine	Oxidation - N-Dealkylation	Aprepitant	[28], [317]
MR002972	Aprepitant	5-oxo-1,4-dihydro-1,2,4-triazole-3-carbaldehyde	Oxidation - N-Dealkylation	Aprepitant	[28], [317]
MR002973	Aprepitant	1-[3,5-bis(trifluoromethyl)phenyl]ethanone	Oxidation - N-Demethylation	Aprepitant	[28], [317]
MR002974	Aprepitant	5-{[(2S,3S)-3-(4-fluorophenyl)-2-hydroxymorpholin-4-yl]methyl}-2,4-dihydro-1,2,4-triazol-3-one	Oxidation - N-Demethylation	Aprepitant	[28], [317]
MR011561	AR-67	AR-67 hypothesize	Unclear - Unclear	AR-67	[249]
MR007494	Arachidonic acid	19-HETE	Other reaction - Omega-hydroxylation	Arachidonic acid	[318]
MR007274	ASA-404	6-OH-MXAA	Unclear - Unclear	ASA-404	[319], [250]
MR009797	AST-1306	Allitinib M10	Unclear - Unclear	AST-1306	[266]
MR007277	AV-650	AV-650 M1	Unclear - Unclear	AV-650	[245]
MR009891	Axitinib	Axitinib Metabolite M14	Unclear - Unclear	axitinib	[320]
MR009890	Axitinib	Axitinib Metabolite M12a	Unclear - Unclear	axitinib	[320]
MR010386	AZD4635	SSP-005174	Unclear - Unclear	AZD4635	[256]
MR003839	BE-14348A	Eriodictyol	Oxidation - Hydrolyzationn	BE-14348A	[267]
MR006038	Bendamustine	-hydroxybendamustine (Bendamustine metabolite M3)	Oxidation - Hydrolyzationn	Bendamustine	[87]
MR006039	Bendamustine	N-desmethyl-bendamustine (Bendamustine metabolite M4)	Oxidation - Dealkylation	Bendamustine	[87]
MR008758	Benzocaine	Benzocaine hydroxylamine	Oxidation - N-hydroxylation	Benzocaine	[116]
MR013779	Berberine	Demethyleneberberine	Oxidation - Demethylenation	Berberine	[321], [190]
MR013789	Berberine	Thalfendine	Oxidation - Demethylation	Berberine	[321], [190], [322]
MR013787	Berberine	Berberrubine	Oxidation - Demethylation	Berberine	[321], [190], [322]
MR013780	Demethyleneberberine	2,3,10-trihydroxyberberine	Oxidation - Demethylation	Berberine	[321], [190]
MR007554	Beta-ionone	(+)-(S)-4-hydroxy--ionone	Oxidation - 4S-hydroxylation	Beta-ionone	[296]
MR007556	Beta-ionone	(?)-(R)-4-hydroxy--ionones	Oxidation - 4-hydroxylation	Beta-ionone	[296]
MR011144	BMS-201038	Lomitapide Metabolite M1	Oxidation - N-dealkylation	BMS-201038	[323]
MR012092	Brivanib	Brivanib Metabolites M7	Unclear - Unclear	BMS-582664	[220]
MR012393	BMS-911543	BMS-911543 M1	Unclear - Unclear	BMS-911543	[246]
MR000411	Bortezomib	Bortezomib metabolite M23	Unclear - Unclear	Bortezomib	[1]
MR000412	Bortezomib	Bortezomib metabolite M24	Unclear - Unclear	Bortezomib	[1]
MR000420	BPI-2009	BPI-2009 metabolite M4	Oxidation - Oxidation	BPI-2009	[212]
MR012083	Brivanib	Brivanib Metabolites M7	Unclear - Unclear	Brivanib	[220]
MR007576	Bromazepam	Unclear	Unclear - Unclear	Bromazepam	[324]
MR000458	Bromfenac indolinone	Bromfenac metabolite M3	Unclear - Unclear	Bromfenac	[325], [326]
MR000457	Bromfenac indolinone	Bromfenac metabolite M2	Unclear - Unclear	Bromfenac	[325], [326]
MR000466	Bromperidol	4-fluorobenzoyl-propionic acid (FBPA)	Unclear - Unclear	Bromperidol	[327]
MR007578	Bufuralol	4-hydroxybufuralol	Oxidation - Hydrolyzationn	Bufuralol	[294]
MR007579	Bufuralol	6-hydroxybufuralol	Oxidation - Hydrolyzationn	Bufuralol	[294]
MR000544	Caffeine	1,3,7-Trimethyluric acid	Oxidation - 8-Hydroxylation	Caffeine	[207], [328]
MR000546	Caffeine	Theophylline	Oxidation - 7-N-Demethylation	Caffeine	[207], [328]
MR000545	Caffeine	Theobromine	Oxidation - 1-N-Demethylation	Caffeine	[207], [328]
MR000543	Caffeine	Paraxanthine	Oxidation - Demethylation	Caffeine	[329], [328]
MR000541	Paraxanthine	1,7-Dimethyluric acid	Oxidation - 3-N-Demethylation	Caffeine	[207], [328]
MR000547	Theophylline	1-Methylxanthine	Oxidation - 3-N-Demethylation	Caffeine	[330], [328]
MR002818	Capsaicin	Capsaicin metabolite M1	Oxidation - Dehydrogenation	Capsaicin	[23]
MR002819	Capsaicin	Capsaicin metabolite M2	Oxidation - Omega-Hydroxylation	Capsaicin	[23]
MR002820	Capsaicin	Capsaicin metabolite M3	Oxidation - Omega-1-Hydroxylation	Capsaicin	[23]
MR002821	Capsaicin	Capsaicin metabolite M4	Oxidation - Dehydrogenation	Capsaicin	[23]
MR002822	Capsaicin	Capsaicin metabolite M5M7	Oxidation - Hydroxylation	Capsaicin	[23]
MR002823	Capsaicin	Capsaicin metabolite M6	Oxidation - O-Dehydrogenation	Capsaicin	[23]
MR002824	Capsaicin	Capsaicin metabolite M8	Oxidation - N-Dehydrogenation; Oxygenation	Capsaicin	[23]
MR002825	Capsaicin	Capsaicin metabolite M9	Oxidation - N-Dehydrogenation	Capsaicin	[23]
MR000572	Carvedilol	O-Desmethylcarvedilol	Oxidation - O-Demethylation	Carvedilol	[331]
MR000573	Carvedilol	1-hydroxyphenylcarvedilol	Oxidation - 1-Hydroxylation	Carvedilol	[331]
MR000569	Carvedilol	8-hydroxycarbazolylcarvedilol	Oxidation - 8-Hydroxylation	Carvedilol	[331]
MR006088	CB-3304	Hydroxylated metabolite	Oxidation - Hydrolyzationn	CB-3304	[262]
MR006089	CB-3304	Hydroxylated metabolite	Oxidation - Hydrolyzationn	CB-3304	[262]
MR006099	CCRIS-1920	CCRIS-1920 Metabolite M4	Oxidation - Oxidationn	CCRIS-1920	[332], [333]
MR006105	CCRIS-1920	CCRIS-1920 Metabolite M3	Oxidation - Oxidationn	CCRIS-1920	[332], [333]
MR006100	CCRIS-1920 Metabolite M4	CCRIS-1920 Metabolite M5	Oxidation - Oxidationn	CCRIS-1920	[332], [333]
MR000643	Chlorpromazine hydrochloride	Hydroxychlorpromazine	Oxidation - 7-Hydroxylation	Chlorpromazine hydrochloride	[334], [335]
MR000642	Chlorpromazine hydrochloride	Demonomethylchlorpromazine	Unclear - Unclear	Chlorpromazine hydrochloride	[334], [335]
MR000645	Chlorpromazine hydrochloride	Opromazine	Unclear - Unclear	Chlorpromazine hydrochloride	[334], [335]
MR000641	Demonomethylchlorpromazine	Dedimethylchlorpromazine	Unclear - Unclear	Chlorpromazine hydrochloride	[334]
MR000650	Chlorpropamide	2-OH-chlorpropamide	Oxidation - Hydroxylation	Chlorpropamide	[1]
MR013303	Cinnarizine	Cinnarizine metabolite M1	Unclear - Unclear	Cinnarizine	[1]
MR013306	Cinnarizine	Cinnamaldehyde	Oxidation - N-dealkylation	Cinnarizine	[336]
MR013307	Cinnarizine	1-Cinnamylpiperazine	Oxidation - N-dealkylation; hydrolysis	Cinnarizine	[336]
MR006557	Clofazimine	Hydrolytic-dehalogenated clofazimine	Other reaction - Hydrolytic Dehalogenation	Clofazimine	[89]
MR009006	8-hydroxyclomipramine	8-hydroxydesmethyl clomipramine	Unclear - Unclear	Clomipramine	[337], [31]
MR009009	Clomipramine	Desmethylclomipramine	Oxidation - N-demethylation	Clomipramine	[337]
MR009010	Desmethylclomipramine	Didesmethylclomipramine	Oxidation - N-demethylation	Clomipramine	[337]
MR006567	Clomipramine hydrochloride	Desmethylclomipramine	Oxidation - N-demethylation	Clomipramine hydrochloride	[338], [339]
MR006570	Desmethylclomipramine	Didesmethylclomipramine	Oxidation - N-demethylation	Clomipramine hydrochloride	[338], [339]
MR006587	Clonidine	4-Hydroxyclonidine	Oxidation - 4-hydroxylation	Clonidine	[90]
MR006591	Clopidogrel bisulfate	2-Oxoclopidogrel	Oxidation - Oxidationn	Clopidogrel bisulfate	[1]
MR002835	Clozapine	N-desmethylclozapine	Oxidation - N-Demethylation	Clozapine	[1]
MR002836	Clozapine	Clozapine N-oxide	Oxidation - N-Oxidation	Clozapine	[1]
MR005309	Coumarin	7-Hydroxycoumarin	Oxidation - Hydroxy Aromaticlation	Coumarin	[290], [340]
MR005306	Coumarin	Coumarin 3,4-epoxide	Oxidation - Epoxidation	Coumarin	[290]
MR007418	CP-125611	Quinone	Unclear - Unclear	CP-122721	[341], [342]
MR007424	CP-677623	CP-919230	Oxidation - O-demethylation	CP-122721	[341], [342]
MR007426	CT-1501R	Pentoxifylline	Unclear - Unclear	CT-1501R	[251]
MR005317	Cyamemazine	N-desmethyl cyamemazine	Oxidation - N-demethylation	Cyamemazine	[343], [302]
MR005318	Cyamemazine	Cyamemazine sulfoxide	Oxidation - Oxidationn	Cyamemazine	[343], [302]
MR006605	Dacarbazine	5-[3-hydroxymethyl-3-methyl-triazen-1-yl]-imidazole-4-carboxamide (HMMTIC)	Unclear - Unclear	Dacarbazine	[344]
MR002839	Dapagliflozin	Dapagliflozin BMS-511926	Oxidation - O-Deethylation	Dapagliflozin	[345]
MR002840	Dapagliflozin	Dapagliflozin BMS-639432	Oxidation - Hydroxylation	Dapagliflozin	[345]
MR007102	Dexfenfluramine	Nordexfenfluramine	Oxidation - N-dealkylation	Dexfenfluramine	[346]
MR000820	Diazepam	Oxazepam	Oxidation - N-Demethylation	Diazepam	[347], [348], [349]
MR002614	Diclofenac sodium	5-hydroxy diclofenac	Oxidation - 5-Hydroxylation	Diclofenac sodium	[350], [351]
MR007114	Dihydralazine	Unclear	Unclear - Unclear	Dihydralazine	[202]
MR011193	Diphenhydramine	N-Desmethyldiphenhydramine	Unclear - Unclear	Dimenhydrinate	[1]
MR000876	Diphenhydramine	N-desmethyldiphenhydramine	Oxidation - N-Demethylation	Diphenhydramine	[352], [1], [353], [354]
MR000872	N-desmethyldiphenhydramine	N,N-didesmethyldiphenhydramine	Oxidation - N-Demethylation	Diphenhydramine	[352], [1], [353]
MR006661	Doxepin hydrochloride	N-desmethyldoxepin	Oxidation - N-demethylation	Doxepin hydrochloride	[337]
MR006715	Duloxetine hydrochloride	5-hydroxy duloxetine	Oxidation - Hydrolyzationn	Duloxetine hydrochloride	[36]
MR006009	DW-1030	DW-1030 Metabolite M4	Unclear - Unclear	DW-1030	[355]
MR013313	E-3A	2-hydroxyestrone	Oxidation - 2-hydroxylation	E-3A	[356]
MR013313	E-3A	2-hydroxyestrone	Oxidation - Aromatic hydroxylation	E-3A	[357]
MR000903	Efavirenz	8-hydroxy-efavirenz	Oxidation - Hydroxylation	Efavirenz	[358], [359], [360], [361]
MR000906	Eltrombopag olamine	Mono-oxygenation	Oxidation - Oxidation	Eltrombopag olamine	[146]
MR006045	EMD-128130	Sarizotan metabolite M364A	Oxidation - Hydrolyzationn	EMD-128130	[231]
MR006041	EMD-128130	EMD 329989	Oxidation - Hydrolyzationn	EMD-128130	[231]
MR006050	EMD-128130	Sarizotan metabolite M203	Conjugation - Glycosylation	EMD-128130	[362]
MR006047	Sarizotan metabolite M203	Sarizotan metabolite M217	Oxidation - Oxidationn	EMD-128130	[231]
MR006047	Sarizotan metabolite M203	Sarizotan metabolite M217	Oxidation - Oxidationn	EMD-128130	[362]
MR006868	AGI-16903	Unclear	Unclear - Unclear	Enasidenib	[363]
MR006867	Enasidenib	AGI-16903	Oxidation - N-dealkylation	Enasidenib	[363]
MR006965	EPX-100	EPX-100 M2	Oxidation - Oxidationn	EPX-100	[288]
MR003018	Erlotinib hydrochloride	Erlotinib M14	Oxidation - O-demethylation	Erlotinib hydrochloride	[21], [4]
MR003007	Erlotinib M2	Erlotinib M14	Oxidation - O-demethylation	Erlotinib hydrochloride	[21], [4]
MR002625	Estradiol	2-hydroxyestrone	Oxidation - 2-Hydroxylation	Estradiol acetate	[364], [310]
MR002625	Estradiol	2-hydroxyestrone	Oxidation - Hydroxylation	Estradiol acetate	[310]
MR002660	17beta-Estradiol-3,17-beta-sulfate	Estrone	Unclear - Unclear	Estradiol cypionate	[209]
MR002648	Estradiol	2-hydroxyestrone	Oxidation - Hydroxylation	Estradiol cypionate	[364], [310]
MR002648	Estradiol	2-hydroxyestrone	Oxidation - 2-Hydroxylation	Estradiol cypionate	[310]
MR002683	17beta-Estradiol-3,17-beta-sulfate	Estrone	Unclear - Unclear	Estradiol valerate	[209]
MR002671	Estradiol	2-hydroxyestrone	Oxidation - Hydroxylation	Estradiol valerate	[364], [310]
MR002671	Estradiol	2-hydroxyestrone	Oxidation - 2-Hydroxylation	Estradiol valerate	[310]
MR002696	Estrone	2-hydroxyestrone	Oxidation - Hydroxylation	Estrone	[8]
MR002701	Estrone	4-OH-estrone	Oxidation - Hydroxylation	Estrone	[21]
MR002706	Estrone	16alpha-OH-estrone	Oxidation - Hydroxylation	Estrone	[21]
MR002703	Estrone	6beta-estrone	Unclear - Unclear	Estrone	[21]
MR002696	Estrone	2-hydroxyestrone	Oxidation - 2-Hydroxylation	Estrone	[8]
MR002721	Ethinyl estradiol	2-hydroxyethinylestradiol	Oxidation - 2-Hydroxylation	Ethinyl estradiol	[365]
MR002722	Ethinyl estradiol	4-hydroxyethinylestradiol	Oxidation - 4-Hydroxylation	Ethinyl estradiol	[365]
MR002723	Ethinyl estradiol	6-hydroxyethinylestradiol	Oxidation - 6-Hydroxylation	Ethinyl estradiol	[365]
MR002724	Ethinyl estradiol	7-hydroxyethinylestradiol	Oxidation - 7-Hydroxylation	Ethinyl estradiol	[365]
MR002725	Ethinyl estradiol	16alpha-hydroxyethinylestradiol	Oxidation - 16-Hydroxylation	Ethinyl estradiol	[365]
MR014077	Ethinylestradiol propanesulfonate	Unclear	Oxidation - 16alpha-hydroxylation	Ethinylestradiol propanesulfonate	[191], [192]
MR007168	6-Hydroxymethyletoricoxib	6-Hydroxymethyletoricoxib-1'-N'-oxide	Oxidation - 1-N-oxidation	Etoricoxib	[1]
MR007163	Etoricoxib	Etoricoxib 1'-N'-oxide	Oxidation - 1-N-oxidation	Etoricoxib	[1]
MR007165	Etoricoxib	6-Hydroxymethyletoricoxib	Other reaction - 6-methylhydroxylation	Etoricoxib	[1]
MR007164	Etoricoxib 1'-N'-oxide	6-Hydroxymethyletoricoxib-1'-N'-oxide	Other reaction - 6-methylhydroxylation	Etoricoxib	[366]
MR000999	Exemestane	17beta-dihydroexemestane	Reduction - Reduction	Exemestane	[367], [368], [369]
MR003400	Febuxostat	Febuxostat metabolite 67M-2	Oxidation - Oxidation	Febuxostat	[370]
MR012196	Fenfluramine	Norfenfluramine	Unclear - Unclear	Fenfluramine	[371]
MR005476	Fexinidazole	Fexinidazole sulfoxide metabolite (M1)	Oxidation - Oxidationn	Fexinidazole	[232], [233]
MR005477	Fexinidazole sulfoxide metabolite (M1)	Fexinidazole sulfone metabolite (M2)	Oxidation - Oxidationn	Fexinidazole	[232], [233]
MR006309	Flavone	6OHF	Unclear - Unclear	Flavone	[293]
MR006310	Flavone	OHFM7	Unclear - Unclear	Flavone	[293]
MR006311	Flavone	OHFM12	Unclear - Unclear	Flavone	[293]
MR006312	Flavone	OHFM11	Unclear - Unclear	Flavone	[293]
MR001051	Flecainide acetate	Meta-O-dealkylated flecainide	Oxidation - Meta-O-Dealkylation	Flecainide acetate	[372], [147]
MR001052	Flecainide acetate	Meta-O-dealkylated lactam	Oxidation - Meta-O-Dealkylation	Flecainide acetate	[372], [147]
MR013905	Flunarizine	Flunarizine M1	Oxidation - N-desalkylation	Flunarizine	[1]
MR013907	Flunarizine	Flunarizine M3	Oxidation - N-desalkylation	Flunarizine	[1]
MR005012	Fluoxetine hydrochloride	Norfluoxetine	Oxidation - N-demethylation	Fluoxetine hydrochloride	[337], [1], [373], [374]
MR005053	Flutamide	2-hydroxyflutamide	Oxidation - Hydrolyzationn	Flutamide	[375]
MR010936	Fluvoxamine	Fluvoxamino alcohol	Unclear - Unclear	Fluvoxamine	[21]
MR010935	Fluvoxamine	Fluvoxamino acid	Unclear - Unclear	Fluvoxamine	[376]
MR001079	Fluvoxamine maleate	Fluvoxamine alcohol	Oxidation - O-Dealkylation	Fluvoxamine maleate	[21]
MR001078	Fluvoxamine maleate	Fluvoxamino acid	Unclear - Unclear	Fluvoxamine maleate	[377]
MR007835	Propofol	4-Hydroxypropofol	Unclear - Unclear	Fospropofol disodium	[16]
MR001093	Frovatriptan	Desmethyl frovatriptan	Unclear - Unclear	Frovatriptan	[95]
MR001094	Frovatriptan	Hydroxylated frovatriptan	Unclear - Unclear	Frovatriptan	[378]
MR001095	Frovatriptan	Hydroxylated N-acetyl desmethyl frovatriptan	Unclear - Unclear	Frovatriptan	[378]
MR001096	Frovatriptan	N-acetyl desmethyl frovatriptan	Unclear - Unclear	Frovatriptan	[378]
MR005814	GTS-21	2-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[252]
MR005812	GTS-21	4-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[252]
MR005812	GTS-21	4-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[252]
MR005814	GTS-21	2-OH-GTS-21	Oxidation - O-demethylation	GTS-21	[252]
MR005061	Guanabenz	Guanoxabenz	Oxidation - N-oxidation	Guanabenz	[379]
MR005079	Haloperidol decanoate	Fluorobenzoylpropionic acid	Unclear - Unclear	Haloperidol decanoate	[380]
MR007030	Hesperetin	Eriodictyol	Oxidation - 4'-demethylation	Hesperetin	[381]
MR006056	Fexinidazole Sulfone M1	Fexinidazole Sulfone M2	Oxidation - Oxidationn	HOE-239	[232]
MR006055	HOE-239	Fexinidazole Sulfone M1	Oxidation - Oxidationn	HOE-239	[232]
MR012974	GS-563117	Idelalisib Metabolite M20	Unclear - Unclear	Idelalisib	[6]
MR012008	Imatinib	Other imatinib metabolites	Unclear - Unclear	Imatinib	[382]
MR004669	Imatinib mesylate	N-Desmethylimatinib	Oxidation - N-demethylation	Imatinib mesylate	[1], [383], [384]
MR004673	Imatinib mesylate	M7 N-oxidation imatinib	Oxidation - N-oxidation	Imatinib mesylate	[384]
MR012989	Imipramine hydrochloride	2-hydroxyimipramine	Oxidation - 2-hydroxylation	Imipramine hydrochloride	[337]
MR012986	Imipramine hydrochloride	Desipramine	Oxidation - N-demethylation	Imipramine hydrochloride	[385]
MR004625	Imipramine	Desipramine	Unclear - Unclear	Imipramine oxide	[386], [387]
MR003660	INCB-024360 Metabolite M11	INCB-024360 Metabolite M12	Oxidation - N-dealkylation	INCB-024360	[388]
MR011241	N-desacetylIndiplon	N-desmethyl-desacetyl-Indiplon	Oxidation - N-demethylation	indiplon	[389]
MR012375	Ladostigil	R-CAI	Oxidation - Depropargylation	Ladostigil	[247]
MR005371	Lauric acid	11-hydroxylauric acid	Oxidation - Hydrolyzationn	Lauric acid	[300]
MR003102	Leflunomide	A77 1726	Oxidation - N-Dealkylation	Leflunomide	[390], [391]
MR010933	Lenvatinib	O-demethyl Lenvatinib	Unclear - Unclear	Lenvatinib	[125]
MR001468	Levobupivacaine	3-hydroxy levobupivacaine	Oxidation - N-Dealkylation	Levobupivacaine	[392]
MR009962	Levomepromazine	Levomepromazine5-sulfoxide	Unclear - Unclear	Levomepromazine	[76]
MR001552	Lidocaine	3-hydroxylidocaine	Oxidation - Hydroxylation	Lidocaine	[393]
MR001550	Lidocaine	Monoethylglycinexylidide	Oxidation - N-De-Ethylation	Lidocaine	[394], [393]
MR001583	Lofexidine	N-(2-aminoethyl)-2-(2,6-dichlorophenoxy)propanamide	Oxidation - Hydroxylation	Lofexidine	[205]
MR001581	N-(2-aminoethyl)-2-(2,6-dichlorophenoxy)propanamide	2,6-dichlorophenol	Oxidation - Oxidative Deamination	Lofexidine	[205]
MR001582	N-(2-aminoethyl)-2-(2,6-dichlorophenoxy)propanamide	2-(2,6-dichlorophenoxy) propionic acid	Oxidation - Oxidative Deamination	Lofexidine	[205]
MR006891	Lomefloxacin	N-Desmethylamifloxacin	Oxidation - N-demethylation	Lomefloxacin	[174]
MR006893	Lomitapide mesylate	Lomitapide metabolite M1	Other reaction - Cleavage	Lomitapide mesylate	[151]
MR006894	Lomitapide mesylate	Lomitapide metabolite M3	Unclear - Unclear	Lomitapide mesylate	[151]
MR006906	Lorcaserin	N-hydroxylorcaserin	Oxidation - Hydrolyzationn	Lorcaserin	[55]
MR006908	Lorcaserin	5-Hydroxylorcaserin	Oxidation - Hydrolyzationn	Lorcaserin	[55]
MR006925	Loxapine succinate	Loxapine N-oxide	Oxidation - Oxidationn	Loxapine succinate	[97]
MR006926	Loxapine succinate	7-Hydroxyloxapine	Oxidation - Oxidationn	Loxapine succinate	[97]
MR006927	Loxapine succinate	Amoxapine	Oxidation - Oxidationn	Loxapine succinate	[97]
MR006928	Loxapine succinate	8-Hydroxyloxapine	Oxidation - Oxidationn	Loxapine succinate	[97]
MR003762	LY-450139	LY-2484595 Metabolite M3	Oxidation - Benzylic hydroxylation	LY-450139	[223]
MR006943	Malathion	Malaoxon	Other reaction - Desulfonization	Malathion	[98]
MR006948	Malathion	Dimethyldithiophosphate	Other reaction - Desulfonization	Malathion	[98]
MR013439	Maprotiline hydrochloride	3-OH-maprotiline	Oxidation - Aromatic hydroxylation	Maprotiline hydrochloride	[21]
MR005532	Maribavir	VP 44469	Oxidation - N-Dealkylation	Maribavir	[217]
MR003317	Melatonin	6-hydroxymelatonin	Oxidation - 6-Hydroxylation	Melatonin	[1]
MR003315	Melatonin	Dihydroxy ketobemidone	Oxidation - O-Demethylation	Melatonin	[1]
MR001645	17alpha-Ethinylestradiol	2-hydroxyethinylestradiol	Oxidation - 2-Hydroxylation	Mestranol	[191], [192]
MR001646	17alpha-Ethinylestradiol	4-hydroxyethinylestradiol	Oxidation - 4-Hydroxylation	Mestranol	[191], [192]
MR001647	17alpha-Ethinylestradiol	6-hydroxyethinylestradiol	Oxidation - 6-Hydroxylation	Mestranol	[191], [192]
MR001648	17alpha-Ethinylestradiol	7-hydroxyethinylestradiol	Oxidation - 7-Hydroxylation	Mestranol	[191], [192]
MR001649	17alpha-Ethinylestradiol	16alpha-hydroxyethinylestradiol	Oxidation - 16-Hydroxylation	Mestranol	[191], [192]
MR009998	Methadone	EDDP	Oxidation - N-demethylation	Methadone	[395], [396]
MR013395	Metoclopramide hydrochloride	Metoclopramide hydrochloride Metabolite M4	Oxidation - Oxidationn	Metoclopramide hydrochloride	[397]
MR013401	Metoclopramide hydrochloride	Metoclopramide hydrochloride Metabolite M3	Oxidation - N-dealkylation	Metoclopramide hydrochloride	[397]
MR013406	Metoclopramide hydrochloride	Metoclopramide hydrochloride Metabolite M10	Oxidation - Nitration	Metoclopramide hydrochloride	[397]
MR004735	Mexiletine hydrochloride	2-hydroxymexiletine	Oxidation - 2-hydroxylation	Mexiletine hydrochloride	[398]
MR004737	Mexiletine hydrochloride	p-hydroxymexiletine	Oxidation - Hydrolyzationn	Mexiletine hydrochloride	[398]
MR001667	8-hydroxyminaserin	8-hydroxy-N-desmethylmianserin	Oxidation - N-Dealkylation	Mianserin	[21]
MR001673	Mianserin	(R)-mianserin,N-Desmethyl	Oxidation - N-Dealkylation	Mianserin	[21]
MR001670	Mianserin	N-desmethylmianserin	Oxidation - N-Oxidation	Mianserin	[21]
MR001668	N-desmethylmianserin	8-hydroxy-N-desmethylmianserin	Oxidation - 8-Hydroxylation	Mianserin	[21]
MR004749	Desglymidodrine	Midodrine Metabolite M-2	Oxidation - 5'-O-demethylation	Midodrine	[131]
MR004787	Mirtazapine	8-hydroxymirtazapine	Oxidation - 8-hydroxylation	Mirtazapine	[399]
MR012692	MKC-442	BIU	Unclear - Unclear	MKC-442	[400]
MR005785	MLN-8054	Unclear	Unclear - Unclear	MLN-8054	[272]
MR005404	MRTX849	Unclear	Unclear - Unclear	MRTX849	[401]
MR004840	3-OH-nabumetone	6-methoxy-2-naphthylacetic acid	Oxidation - Dealkylation	Nabumetone	[402]
MR003383	R-Naftopidil	R-Naftopidil metabolite M2	Unclear - Unclear	Naftopidil	[403], [404]
MR004871	Naproxen	O-Desmethylnaproxen	Oxidation - O-demethylation	Naproxen	[1], [56], [405], [406]
MR009257	N-despropyl-rotigotine	Neupro Metabolite M2	Unclear - Unclear	Neupro	[407], [194]
MR009255	Neupro	N-despropyl-rotigotine	Unclear - Unclear	Neupro	[407], [194]
MR001730	Nicardipine hydrochloride	Dehydronicardipine	Oxidation - Heteroring Dehydrogenation	Nicardipine hydrochloride	[310], [134], [408]
MR001734	Niclosamide	3-hydroxy niclosamide	Oxidation - Hydroxylation	Niclosamide	[409]
MR003319	4-hydroxynimesulideM1	Nimesulide metabolite M2	Unclear - Unclear	Nimesulide	[410]
MR013613	NITD609 Metabolite M18	NITD609 Metabolite M23	Unclear - Unclear	NITD609	[236]
MR004363	Nitrobenzanthrone	3-OH-ABA	Reduction - Reduction	Nitrobenzanthrone	[411]
MR007640	Nomifensine	Nomifensine H1	Unclear - Unclear	Nomifensine	[281]
MR007638	Nomifensine	Nomifensine H4	Unclear - Unclear	Nomifensine	[281]
MR001796	Nortriptyline hydrochloride	Desmethylnortriptyline	Unclear - Unclear	Nortriptyline hydrochloride	[412], [413]
MR007646	NSC-149027	NSC-149027 M4	Oxidation - Oxidationn	NSC-149027	[282]
MR004429	6-O-benzyl-8-oxoguanine	8-oxoguanine	Oxidation - Debenzylation	O-Benzylguanine	[414]
MR004428	O-Benzylguanine	6-O-benzyl-8-oxoguanine	Oxidation - Oxidationn	O-Benzylguanine	[414]
MR001802	Olanzapine	7-hydroxyolanzapine	Oxidation - 7-Hydroxylation	Olanzapine	[415], [416]
MR001803	Olanzapine	4'-N-desmethylolanzapine	Oxidation - N-Demethylation	Olanzapine	[415], [416]
MR001805	Olanzapine	Olanzapine 10-N-glucuronide metabolite	Conjugation - Glucuronidation	Olanzapine	[415], [416]
MR001836	Ondansetron	7-OH-ondansetron	Oxidation - Hydroxylation	Ondansetron	[21], [417]
MR001839	Ondansetron	8-OH-ondansetron	Oxidation - Hydroxylation	Ondansetron	[21]
MR001840	Ondansetron	6-OH-ondansetron	Oxidation - Hydroxylation	Ondansetron	[417]
MR001874	Oxtriphylline	1,3-Dimethyluric acid	Unclear - Unclear	Oxtriphylline	[418]
MR003337	Paroxetine hydrochloride	Paroxetine catechol	Unclear - Unclear	Paroxetine hydrochloride	[1], [419]
MR001948	Pazopanib	Pazopanib hydrochloride	Oxidation - Hydroxylation; N-Demethylation	Pazopanib	[420], [101], [421]
MR001952	PD-115934	9-desmethyl-PZA	Unclear - Unclear	PD-115934	[157]
MR001978	Lisofylline	Pentoxifylline metabolite M7	Oxidation - Demethylation	Pentoxifylline	[422]
MR001984	Pentoxifylline	Pentoxifylline metabolite M6	Oxidation - Demethylation	Pentoxifylline	[423]
MR001985	N-desmethylperazine	N-{3-(phenothiazinyl-10)-propyl}ethylenediamine	Oxidation - N-Dealkylation	Perazine	[424]
MR001987	Perazine	Perazine 5-sulfoxide metabolite	Oxidation - Sulphoxidation	Perazine	[424]
MR002005	Perphenazine	N-Dealkylated perphenazine	Oxidation - N-Dealkylation	Perphenazine	[425]
MR002014	Acetaminophen	NAPQI	Oxidation - Oxidation	Phenacetin	[426]
MR002010	Phenacetin	N-OH-phenacetin	Oxidation - N-Oxidation	Phenacetin	[426]
MR002011	Phenacetin	Acetaminophen	Oxidation - O-Deethylation	Phenacetin	[426]
MR002036	Phenytoin	Phenytoin dihydrodiol	Oxidation - Dihydroxylation; Oxidation	Phenytoin	[1]
MR002038	Pimozide	DHBPI	Oxidation - N-Dealkylation	Pimozide	[427]
MR003332	Pirfenidone	5-hydroxy pirfenidone	Oxidation - 5-Hydroxylation	Pirfenidone	[428], [429], [430]
MR002076	Pomalidomide	5-hydroxypomalidomide	Oxidation - Hydroxylation	Pomalidomide	[431], [432], [433]
MR002077	Pomalidomide	7-hydroxypomalidomide	Oxidation - Hydroxylation	Pomalidomide	[431], [432], [433]
MR002079	Pomalidomide	Pomalidomide metabolite M19	Oxidation - Hydroxylation	Pomalidomide	[431], [432]
MR002112	Praziquantel	10-hydroxypraziquantel	Oxidation - Hydroxylation	Praziquantel	[434], [435], [18]
MR002165	Procarbazine	Azoprocarbazine	Unclear - Unclear	Procarbazine	[436], [437]
MR002172	Progesterone	Desoxycortone	Oxidation - Hydroxylation	Progesterone	[438]
MR002782	Promazine	N-Desmethylpromazine	Oxidation - N-Demethylation	Promazine	[78]
MR002781	Promazine	Promazine 5-sulfoxide	Oxidation - 5-Sulphoxidation	Promazine	[78]
MR002880	Propafenone hydrochloride	N-depropylpropafenone	Oxidation - N-Dealkylation	Propafenone hydrochloride	[439]
MR002882	Propafenone hydrochloride	(S)-N-Despropylpropafenone	Oxidation - N-Dealkylation	Propafenone hydrochloride	[310]
MR002192	Propranolol hydrochloride	N-desisopropylpropranolol	Oxidation - N-Desisopropylation	Propranolol hydrochloride	[440]
MR013648	PT2385	PT2385 M10	Oxidation - Hydroxylation	PT2385	[238]
MR013646	PT2385	PT2385 M2	Oxidation - Hydroxylation	PT2385	[238]
MR013642	PT2385	PT2385 M7	Oxidation - Oxidative Defluorination	PT2385	[238]
MR010018	Quinine sulfate	Quinine sulfate Metabolite M3	Oxidation - Demethylation	Quinine sulfate	[441]
MR005213	Ramosetron	Unclear	Unclear - Unclear	Ramosetron	[442], [206]
MR013046	Ranitidine	Desmethylranitidine	Oxidation - N-demethylation	Ranitidine	[443]
MR009513	Rasagiline mesylate	Unclear	Unclear - Unclear	Rasagiline mesylate	[444]
MR009542	Riluzole	N-OH-riluzole	Oxidation - N-oxidation	Riluzole	[21]
MR007663	RO-408757	Unclear	Unclear - Unclear	RO-408757	[283]
MR013062	Rofecoxib	5-OH-rofecoxib	Other reaction - Hydoxylation	Rofecoxib	[1]
MR009562	Roflumilast	Roflumilast N-oxide	Oxidation - N-oxidation	Roflumilast	[177], [445]
MR009563	Ropinirole hydrochloride	SK&F-104557	Oxidation - N-despropylation	Ropinirole hydrochloride	[446], [447]
MR009568	Ropivacaine hydrochloride	3-hydroxyropivacaine	Oxidation - 3-hydroxylation	Ropivacaine hydrochloride	[448]
MR009570	Ropivacaine hydrochloride	4-Hydroxyropivacaine	Oxidation - 4-hydroxylation	Ropivacaine hydrochloride	[449]
MR009572	Ropivacaine hydrochloride	PPX	Oxidation - N-dealkylation	Ropivacaine hydrochloride	[450], [451]
MR002210	Rucaparib	Rucaparib M323 metabolite	Oxidation - Oxidation	Rucaparib	[452]
MR002211	Rucaparib	Rucaparib M324 metabolite	Oxidation - Oxidation	Rucaparib	[452], [453]
MR002212	Rucaparib	Rucaparib M309 metabolite	Oxidation - N-Demethylation	Rucaparib	[452]
MR002213	Rucaparib	Rucaparib M337b metabolite	Oxidation - Oxidation	Rucaparib	[452]
MR012411	Saracatinib	Saracatinib M2	Unclear - Unclear	Saracatinib	[244]
MR012412	Saracatinib	Saracatinib M3	Unclear - Unclear	Saracatinib	[244]
MR012413	Saracatinib	Saracatinib M4	Unclear - Unclear	Saracatinib	[244]
MR010185	Savolitinib	Savolitinib Metabolite M2	Unclear - Unclear	Savolitinib	[454]
MR006440	SB-939	SB-939 Metabolite M1	Oxidation - N-deethylation	SB-939	[218]
MR006447	SC-15090	7-MX	Oxidation - N7-demethylation	SC-15090	[222]
MR006464	SHP-620	VP 44469	Oxidation - N-dealkylation	SHP-620	[217]
MR008502	SMT-C1100	DHD1	Unclear - Unclear	SMT-C1100	[254]
MR008503	SMT-C1100	DHD3	Unclear - Unclear	SMT-C1100	[254]
MR006834	Sorafenib	Pyridine N-oxide glucuronide	Multi-steps Reaction - Oxidationn; glucuronidation	Sorafenib	[337], [455]
MR006833	Sorafenib	Pyridostigmine	Oxidation - Oxidationn	Sorafenib	[337]
MR006468	SRT-501	Piceatannol	Oxidation - Hydrolyzationn	SRT-501	[362]
MR006470	SRT-501	Trans-Resveratrol 3-O-\|A-D-Glucuronide	Conjugation - Glycosylation	SRT-501	[362]
MR006841	Stiripentol	Stiripentol metabolite II	Multi-steps Reaction - Oxidationn cleavage; demethylenation	Stiripentol	[456]
MR008084	Sulindac	Sulindac sulfone	Oxidation - Oxidation	Sulindac	[161]
MR010641	N-Desmethyl sumatriptan	N-Desmethyl sumatriptan	Unclear - Unclear	Sumatriptan	[109]
MR010640	Sumatriptan	N-Desmethyl sumatriptan	Unclear - Unclear	Sumatriptan	[109]
MR010647	Sumatriptan	Sumatriptan N-oxide	Unclear - Unclear	Sumatriptan	[109]
MR008647	Sunitinib malate	Sunitinib malate Metabolite M8	Reduction - Reduction	Sunitinib malate	[457], [458]
MR002899	Tacrine hydrochloride	7-hydroxytacrine	Oxidation - Hydroxylation	Tacrine hydrochloride	[21]
MR003510	Tamoxifen citrate	N-Desmethyltamoxifen	Oxidation - N-Dealkylation	Tamoxifen citrate	[459], [3], [460], [461], [462]
MR002340	Tasimelteon	Tasimelteon metabolite M13	Oxidation - Hydroxylation	Tasimelteon	[110]
MR002342	Tasimelteon	Inosine	Oxidation - Hydroxylation	Tasimelteon	[110]
MR002338	Tasimelteon metabolite M13	Tasimelteon metabolite M9	Unclear - Unclear	Tasimelteon	[110]
MR002339	Tasimelteon metabolite M13	Tasimelteon metabolite M11	Unclear - Unclear	Tasimelteon	[110]
MR005270	5'-hydroxytegafur	Fluorouracil	Other reaction - Degradation	Tegafur	[134], [121]
MR002399	Hydroxyterbinafine	N-Desmethylhydroxyterbinafine	Oxidation - N-Demethylation	Terbinafine hydrochloride	[26], [463]
MR002400	Hydroxyterbinafine	Carboxyterbinafine	Oxidation - Oxidation	Terbinafine hydrochloride	[26]
MR002401	N-Desmethylterbinafine	N-Desmethylhydroxyterbinafine	Oxidation - Hydoxylation	Terbinafine hydrochloride	[26]
MR002402	N-Desmethylterbinafine	N-Desmethylterbinafine dihydrodiol derivative (2)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[26]
MR002403	N-Desmethylterbinafine	N-Desmethylterbinafine dihydrodiol derivative (1)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[26]
MR002406	Terbinafine dihydrodiol derivative (1)	N-Desmethylterbinafine dihydrodiol derivative (1)	Oxidation - N-Demethylation	Terbinafine hydrochloride	[26]
MR002407	Terbinafine dihydrodiol derivative (2)	N-Desmethylterbinafine dihydrodiol derivative (2)	Oxidation - N-Demethylation	Terbinafine hydrochloride	[26]
MR002409	Terbinafine hydrochloride	N-Desmethylterbinafine	Oxidation - N-Demethylation	Terbinafine hydrochloride	[26]
MR002410	Terbinafine hydrochloride	1-Naphthaldehyde	Oxidation - Deamination	Terbinafine hydrochloride	[26]
MR002408	Terbinafine hydrochloride	Hydroxyterbinafine	Oxidation - Hydoxylation	Terbinafine hydrochloride	[26]
MR002411	Terbinafine hydrochloride	Terbinafine dihydrodiol derivative (1)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[26]
MR002412	Terbinafine hydrochloride	Terbinafine dihydrodiol derivative (2)	Oxidation - Dihydroxylation	Terbinafine hydrochloride	[26]
MR004939	Thalidomide	Thalidomide arene oxide	Oxidation - Epoxidation	Thalidomide	[1], [2]
MR004944	Theophylline	1-Methylxanthine	Oxidation - 3-N-demethylation	Theophylline	[464]
MR004946	Theophylline	3-methylxanthine	Oxidation - 1-N-demethylation	Theophylline	[464]
MR004949	Thiabendazole	5-hydroxythiabendazole	Unclear - Unclear	Thiabendazole	[465], [466]
MR004959	Thioridazine	N-desmethylthioridazine	Oxidation - N-dealkylation	Thioridazine	[112]
MR004960	Thioridazine	Thioridazine 5-sulfoxide	Oxidation - S-oxidation	Thioridazine	[112]
MR004995	M1 metabolite, timolol	Timolol maleate Metabolite M4	Unclear - Unclear	Timolol maleate	[141]
MR004997	Timolol maleate	Timolol maleate Metabolite M2	Unclear - Unclear	Timolol maleate	[141]
MR004994	Timolol maleate	M1 metabolite, timolol	Oxidation - Hydrolyzationn	Timolol maleate	[141], [467]
MR005010	Tizanidine hydrochloride	5-chloro-4-(guanidino)-2,1,3-benzothiadiazole	Unclear - Unclear	Tizanidine hydrochloride	[468]
MR005011	Tizanidine hydrochloride	5-chloro-4-(2- imidazolin-4-on-2-ylamino)-2,1,3-benzothiazdiazole	Unclear - Unclear	Tizanidine hydrochloride	[468]
MR002451	Triamterene	4'-OH-triamterene	Oxidation - Hydroxylation	Triamterene	[112], [179]
MR002908	Triclabendazole	TCBZ-SX	Oxidation - Oxidation	Triclabendazole	[469], [470]
MR002456	Trimethoprim	3-NO-TMP	Oxidation - N-Oxidation	Trimethoprim	[64]
MR002469	PGL4002	PGL-4004	Oxidation - Di-N-Demethylation	Ulipristal	[471]
MR002471	Ulipristal	PGL4002	Oxidation - Mono-N-Demethylation	Ulipristal	[471]
MR005647	Verapamil hydrochloride	Norverapamil	Oxidation - N-demethylation	Verapamil hydrochloride	[1]
MR010458	Verubulin	MPI-0440627	Oxidation - O-demethylation	Verubulin	[255]
MR013263	Warfarin sodium	R-6-Hydroxywarfarin	Oxidation - 6-hydroxylation	Warfarin sodium	[472], [78]
MR013267	Warfarin sodium	R-8-Hydroxywarfarin	Oxidation - 8-hydroxylation	Warfarin sodium	[472], [78]
MR013258	Warfarin sodium	R-7-Hydroxywarfarin	Oxidation - 7-hydroxylation	Warfarin sodium	[472], [78]
MR012201	YM-17E	YM-17E M1	Unclear - Unclear	YM-17E	[280]
MR013298	Dehydroxyzyleuton	OH-dehydroxyzileuton	Oxidation - Hydrolyzationn	Zileuton	[1], [21]
MR013299	Zileuton	Hydroxyzileuton	Oxidation - Hydrolyzationn	Zileuton	[1], [21]
MR005683	Zileuton	Zolmitriptan N-oxide	Oxidation - N-oxidation	Zolmitriptan	[473], [474]
MR005680	Zolmitriptan	N-Desmethylzolmitriptan	Oxidation - N-dealkylation	Zolmitriptan	[473], [474]
MR005696	Zolpidem tartrate	Methoxyzolpidem derivative (M3)	Oxidation - Methyl-hydroxylation	Zolpidem tartrate	[1], [475]
MR005702	Zolpidem tartrate	Methoxyzolpidem	Oxidation - Aliphatic hydroxylation	Zolpidem tartrate	[1], [475]
MR005698	Zolpidem tartrate	Methoxyzolpidem derivative (M4)	Oxidation - Methyl-hydroxylation; oxidation	Zolpidem tartrate	[1], [475]
MR013081	Zotepine	Norzotepine	Oxidation - N-demethylation	Zotepine	[21], [476]
MR013084	Zotepine	3-OH-zotepine	Oxidation - Aromatic hydroxylation	Zotepine	[21]
MR013085	Zotepine	Zotepine S-oxide	Oxidation - S-oxidation	Zotepine	[21]
MR013083	Zotepine	2-OH-zotepine	Oxidation - Aromatic hydroxylation	Zotepine	[21]


⏷ Show the Full List of 380 MR(s)

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1C1H	Necrotising ulcerative gingivitis	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.68E-01; Fold-change: 7.33E-03; Z-score: 2.32E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E30	Influenza	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1E30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.38E-02; Fold-change: 4.76E-01; Z-score: 2.31E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1E51	Chronic viral hepatitis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.87E-01; Fold-change: 5.65E-02; Z-score: 4.21E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.42E-02; Fold-change: 4.07E-02; Z-score: 1.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA40	Respiratory syncytial virus infection	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.47E-02; Fold-change: 4.02E-02; Z-score: 3.91E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA42	Rhinovirus infection	Click to Show/Hide
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.28E-01; Fold-change: -5.04E-02; Z-score: -5.16E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: KA60	Neonatal sepsis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.46E-02; Fold-change: -1.52E-01; Z-score: -6.66E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.68E-18; Fold-change: -1.46E-01; Z-score: -5.75E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.80E-01; Fold-change: -3.78E-02; Z-score: -2.75E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.78E-06; Fold-change: -1.01E+00; Z-score: -3.20E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.17E-05; Fold-change: -7.40E-01; Z-score: -2.38E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A20	Myeloproliferative neoplasm	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.49E-01; Fold-change: 1.64E-02; Z-score: 1.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.17E-01; Fold-change: 4.45E-03; Z-score: 3.46E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.12E-01; Fold-change: 3.88E-03; Z-score: 1.91E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.09E-02; Fold-change: -3.95E-01; Z-score: -2.70E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.86E-01; Fold-change: -1.05E-01; Z-score: -5.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.57E-01; Fold-change: -2.61E-02; Z-score: -1.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.91E-02; Fold-change: -2.13E-01; Z-score: -9.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.09E-03; Fold-change: 2.84E-02; Z-score: 1.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.86E-04; Fold-change: -2.07E-01; Z-score: -8.44E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.38E-02; Fold-change: -6.23E-02; Z-score: -1.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.12E-02; Fold-change: -2.22E-01; Z-score: -1.32E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-01; Fold-change: -4.22E-01; Z-score: -1.43E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.23E-06; Fold-change: 1.68E-01; Z-score: 1.33E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.40E-09; Fold-change: -1.57E-01; Z-score: -6.38E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.39E-01; Fold-change: -7.32E-03; Z-score: -3.62E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.43E-01; Fold-change: 9.13E-02; Z-score: 3.60E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.24E-01; Fold-change: -3.09E-02; Z-score: -2.26E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.07E-01; Fold-change: -1.65E-01; Z-score: -4.62E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.75E-01; Fold-change: -1.73E-01; Z-score: -7.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.81E-28; Fold-change: -4.64E+00; Z-score: -4.14E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.99E-115; Fold-change: -4.51E+00; Z-score: -4.21E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 2.85E-14; Fold-change: -4.79E+00; Z-score: -2.82E+01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.52E-19; Fold-change: -2.25E-01; Z-score: -5.53E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.68E-11; Fold-change: -2.55E-01; Z-score: -8.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.08E-01; Fold-change: 4.54E-02; Z-score: 8.43E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.21E-12; Fold-change: -2.23E-01; Z-score: -4.75E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.24E-02; Fold-change: 1.36E-01; Z-score: 2.70E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.34E-02; Fold-change: -5.62E-03; Z-score: -1.44E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.29E-02; Fold-change: -8.55E-02; Z-score: -3.43E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.57E-01; Fold-change: -2.01E-01; Z-score: -6.73E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.60E-03; Fold-change: 1.33E-01; Z-score: 6.21E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C77	Cervical cancer	Click to Show/Hide
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.02E-01; Fold-change: -9.34E-02; Z-score: -4.78E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.25E-08; Fold-change: -1.79E-01; Z-score: -6.25E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.93E-02; Fold-change: 3.82E-01; Z-score: 1.62E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.89E-02; Fold-change: -3.74E-01; Z-score: -6.96E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.44E-01; Fold-change: -3.59E-01; Z-score: -1.14E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.05E-14; Fold-change: -5.81E-01; Z-score: -1.87E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.20E-01; Fold-change: -1.49E-01; Z-score: -4.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.80E-03; Fold-change: 5.04E-01; Z-score: 1.94E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.36E-02; Fold-change: -1.81E-01; Z-score: -1.54E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.17E-03; Fold-change: -1.33E-01; Z-score: -4.42E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.16E-04; Fold-change: -2.84E-01; Z-score: -9.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 7.28E-02; Fold-change: -9.14E-02; Z-score: -2.74E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.93E-01; Fold-change: 2.93E-01; Z-score: 6.82E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.18E-02; Fold-change: 4.85E-02; Z-score: 2.43E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.26E-01; Fold-change: -3.16E-02; Z-score: -1.31E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.47E-01; Fold-change: 1.36E-01; Z-score: 5.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3A70	Aplastic anaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.93E-01; Fold-change: 3.11E-01; Z-score: 8.10E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.75E-01; Fold-change: 4.94E-02; Z-score: 4.06E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.45E-01; Fold-change: 4.11E-01; Z-score: 1.01E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A00	Immunodeficiency	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.10E-01; Fold-change: 3.91E-02; Z-score: 2.93E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.82E-02; Fold-change: 6.06E-02; Z-score: 1.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.03E-01; Fold-change: -3.32E-02; Z-score: -3.25E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.58E-01; Fold-change: -1.57E-01; Z-score: -1.10E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.73E-01; Fold-change: -3.25E-02; Z-score: -2.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.40E-01; Fold-change: 5.14E-02; Z-score: 3.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4B04	Monocyte count disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.11E-01; Fold-change: 4.86E-03; Z-score: 2.07E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.35E-02; Fold-change: 7.63E-02; Z-score: 7.60E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.25E-01; Fold-change: -4.04E-01; Z-score: -5.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.40E-01; Fold-change: 4.31E-03; Z-score: 3.22E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.21E-01; Fold-change: -1.54E-01; Z-score: -1.17E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C56	Lysosomal disease	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.58E-01; Fold-change: -2.44E-02; Z-score: -2.37E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.47E-01; Fold-change: 2.03E-02; Z-score: 1.38E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.57E-07; Fold-change: -2.91E-01; Z-score: -1.32E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A02	Autism spectrum disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.97E-01; Fold-change: -3.00E-02; Z-score: -1.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.73E-02; Fold-change: 6.49E-02; Z-score: 3.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.45E-01; Fold-change: 2.07E-02; Z-score: 1.74E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.61E-01; Fold-change: -1.90E-02; Z-score: -1.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.16E-01; Fold-change: -3.19E-02; Z-score: -1.62E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.68E-01; Fold-change: 3.64E-02; Z-score: 2.72E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.46E-01; Fold-change: -6.63E-03; Z-score: -4.49E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A01	Choreiform disorder	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-01; Fold-change: 8.50E-02; Z-score: 5.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.36E-01; Fold-change: 1.62E-02; Z-score: 1.08E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.83E-02; Fold-change: -8.34E-02; Z-score: -4.89E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.96E-01; Fold-change: -7.53E-02; Z-score: -5.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.35E-02; Fold-change: -1.45E-01; Z-score: -7.56E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 4.13E-01; Fold-change: 3.57E-02; Z-score: 2.91E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.71E-01; Fold-change: 2.51E-02; Z-score: 1.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B01	Subarachnoid haemorrhage	Click to Show/Hide
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.95E-01; Fold-change: 6.90E-02; Z-score: 3.70E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.40E-01; Fold-change: -5.05E-02; Z-score: -3.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.40E-02; Fold-change: 1.42E-01; Z-score: 6.39E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B60	Motor neuron disease	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.78E-01; Fold-change: -1.19E-01; Z-score: -1.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.96E-02; Fold-change: 5.36E-01; Z-score: 1.70E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C70	Muscular dystrophy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.66E-01; Fold-change: -1.64E-01; Z-score: -9.58E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.39E-01; Fold-change: -4.78E-02; Z-score: -2.19E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 09	Visual system disease	Click to Show/Hide
ICD-11: 9A96	Anterior uveitis	Click to Show/Hide
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.41E-01; Fold-change: -5.06E-02; Z-score: -3.68E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.89E-01; Fold-change: 1.87E-01; Z-score: 3.46E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BA80	Coronary artery disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.37E-01; Fold-change: -1.71E-01; Z-score: -1.07E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: BB70	Aortic valve stenosis	Click to Show/Hide
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.87E-01; Fold-change: 2.16E-02; Z-score: 3.19E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: 7A40	Central sleep apnoea	Click to Show/Hide
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.45E-01; Fold-change: -2.01E-01; Z-score: -9.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.55E-02; Fold-change: 3.24E-01; Z-score: 3.18E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA0A	Chronic rhinosinusitis	Click to Show/Hide
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.58E-01; Fold-change: 8.92E-02; Z-score: 6.05E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA22	Chronic obstructive pulmonary disease	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-01; Fold-change: 1.11E-01; Z-score: 3.52E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.15E-01; Fold-change: -4.48E-02; Z-score: -1.91E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.57E-07; Fold-change: -1.95E-01; Z-score: -4.24E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.17E-01; Fold-change: -1.52E-01; Z-score: -5.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.39E-01; Fold-change: 3.28E-02; Z-score: 1.03E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.86E-01; Fold-change: -3.06E-01; Z-score: -2.02E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.12E-01; Fold-change: -4.38E-02; Z-score: -3.17E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.41E-08; Fold-change: -4.43E+00; Z-score: -5.74E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.06E-01; Fold-change: 2.42E-02; Z-score: 9.02E-02
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: DD91	Irritable bowel syndrome	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.61E-02; Fold-change: 4.91E-02; Z-score: 2.36E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA80	Atopic eczema	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.19E-04; Fold-change: 1.36E-01; Z-score: 1.10E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.87E-15; Fold-change: -3.01E-01; Z-score: -6.41E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.42E-01; Fold-change: 3.12E-01; Z-score: 6.07E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.27E-01; Fold-change: -1.60E-01; Z-score: -3.99E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: ED70	Alopecia or hair loss	Click to Show/Hide
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.61E-01; Fold-change: 1.30E-02; Z-score: 4.47E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: EK0Z	Contact dermatitis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.39E-01; Fold-change: -5.00E-02; Z-score: -4.71E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 15	Musculoskeletal system/connective tissue disease	Click to Show/Hide
ICD-11: FA00	Osteoarthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.58E-01; Fold-change: 5.31E-02; Z-score: 3.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.49E-01; Fold-change: -7.95E-02; Z-score: -4.15E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA20	Rheumatoid arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Childhood onset rheumatic disease [ICD-11:FA20.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.84E-01; Fold-change: 8.25E-02; Z-score: 5.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.68E-02; Fold-change: -2.10E-01; Z-score: -6.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA24	Juvenile idiopathic arthritis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.08E-03; Fold-change: 8.52E-02; Z-score: 4.34E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FA92	Inflammatory spondyloarthritis	Click to Show/Hide
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.79E-01; Fold-change: -4.52E-03; Z-score: -4.20E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: FB83	Low bone mass disorder	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.54E-02; Fold-change: 2.08E-01; Z-score: 1.34E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GA10	Endometriosis	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.54E-01; Fold-change: -5.96E-03; Z-score: -1.84E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.89E-01; Fold-change: -1.42E-01; Z-score: -6.04E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 19	Condition originating in perinatal period	Click to Show/Hide
ICD-11: KA21	Short gestation disorder	Click to Show/Hide
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.65E-01; Fold-change: -5.01E-02; Z-score: -9.53E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.54E-01; Fold-change: 3.27E-02; Z-score: 5.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.06E-01; Fold-change: 1.61E-01; Z-score: 1.16E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
2	Thalidomide metabolism and hydrolysis: mechanisms and implications
3	Endoxifen and other metabolites of tamoxifen inhibit human hydroxysteroid sulfotransferase 2A1 (hSULT2A1). Drug Metab Dispos. 2014 Nov;42(11):1843-50.
4	Clinical pharmacokinetics of tyrosine kinase inhibitors. Cancer Treat Rev. 2009 Dec;35(8):692-706.
5	Optimizing outcomes with alosetron hydrochloride in severe diarrhea-predominant irritable bowel syndrome. Therap Adv Gastroenterol. 2010 May;3(3):165-72.
6	Identification of Novel Pathways in Idelalisib Metabolism and Bioactivation
7	Metabolism of R- and S-warfarin by CYP2C19 into four hydroxywarfarins. Drug Metab Lett. 2012 Sep 1;6(3):157-64.
8	Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms. Endocrinology. 2003 Aug;144(8):3382-98.
9	Inhibition of the human liver microsomal and human cytochrome P450 1A2 and 3A4 metabolism of estradiol by deployment-related and other chemicals. Drug Metab Dispos. 2006 Sep;34(9):1606-14.
10	A transgenic mouse expressing human CYP1A2 in the pancreas. Biochem Pharmacol. 2000 Sep 15;60(6):857-63.
11	Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70.
12	Apremilast (Otezla): a new oral treatment for adults with psoriasis and psoriatic arthritis. P T. 2015 Aug;40(8):495-500.
13	A predominate role of CYP1A2 for the metabolism of nabumetone to the active metabolite, 6-methoxy-2-naphthylacetic acid, in human liver microsomes. Drug Metab Dispos. 2009 May;37(5):1017-24.
14	Human metabolism of the proteasome inhibitor bortezomib: identification of circulating metabolites. Drug Metab Dispos. 2005 Jun;33(6):771-7.
15	Metabolism and metabolic inhibition of xanthotoxol in human liver microsomes. Evid Based Complement Alternat Med. 2016;2016:5416509.
16	Metabolic Profiles of Propofol and Fospropofol: Clinical and Forensic Interpretative Aspects
17	Metoclopramide is metabolized by CYP2D6 and is a reversible inhibitor, but not inactivator, of CYP2D6. Xenobiotica. 2014 Apr;44(4):309-319.
18	Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
19	DrugBank(Pharmacology-Metabolism):Almogran
20	The effect of apigenin on pharmacokinetics of imatinib and its metabolite N-desmethyl imatinib in rats. Biomed Res Int. 2013;2013:789184.
21	Synthetic and natural compounds that interact with human cytochrome P450 1A2 and implications in drug development. Curr Med Chem. 2009;16(31):4066-218.
22	Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells Chem Res Toxicol. 2003 Mar;16(3):336-49. doi: 10.1021/tx025599q.
23	Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
24	Erythromycin interaction with risperidone or clomipramine in an adolescent. J Child Adolesc Psychopharmacol. 1996 Summer;6(2):133-8.
25	Acute pancreatitis in a patient treated with imatinib and gefitinib. J Oncol Pharm Pract. 2021 Jun;27(4):980-983. doi: 10.1177/1078155220949639.
26	Multiple cytochrome P-450s involved in the metabolism of terbinafine suggest a limited potential for drug-drug interactions. Drug Metab Dispos. 1999 Sep;27(9):1029-38.
27	Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan Drug Metab Dispos. 2003 Apr;31(4):404-11. doi: 10.1124/dmd.31.4.404.
28	Cytochrome P450 3A4 is the major enzyme involved in the metabolism of the substance P receptor antagonist aprepitant. Drug Metab Dispos. 2004 Nov;32(11):1287-92.
29	Asenapine review, part I: chemistry, receptor affinity profile, pharmacokinetics and metabolism. Expert Opin Drug Metab Toxicol. 2014 Jun;10(6):893-903.
30	Drugs that may have potential CYP1A2 interactions.
31	The effect of CYP2C19 and CYP2D6 genotypes on the metabolism of clomipramine in Japanese psychiatric patients. J Clin Psychopharmacol. 2001 Dec;21(6):549-55.
32	The biotransformation of clomipramine in vitro, identification of the cytochrome P450s responsible for the separate metabolic pathways. J Pharmacol Exp Ther. 1996 Jun;277(3):1659-64.
33	Effect of conjugated equine estrogens on oxidative metabolism in middle-aged and elderly postmenopausal women. J Clin Pharmacol. 2006 Nov;46(11):1299-307.
34	Identification of human liver cytochrome P450 isoforms involved in the in vitro metabolism of cyclobenzaprine. Drug Metab Dispos. 1996 Jul;24(7):786-91.
35	The effect of new lipophilic chelators on the activities of cytosolic reductases and P450 cytochromes involved in the metabolism of anthracycline antibiotics: studies in vitro. Physiol Res. 2004;53(6):683-91.
36	Duloxetine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2011 May;50(5):281-94.
37	In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition Xenobiotica. 2008 May;38(5):496-510. doi: 10.1080/00498250801956350.
38	Phase 1/2 trial of ixazomib, cyclophosphamide and dexamethasone in patients with previously untreated symptomatic multiple myeloma. Blood Cancer J. 2018 Jul 30;8(8):70.
39	Cytochrome P450 1A1/2 induction by antiparasitic drugs: dose-dependent increase in ethoxyresorufin O-deethylase activity and mRNA caused by quinine, primaquine and albendazole in HepG2 cells. Eur J Clin Pharmacol. 2002 Nov;58(8):537-42.
40	Modulation of CYP1A2 enzyme activity by indoleamines: inhibition by serotonin and tryptamine. Pharmacogenetics. 1998 Jun;8(3):251-8.
41	Effect of fluvoxamine on the pharmacokinetics of roflumilast and roflumilast N-oxide. Clin Pharmacokinet. 2007;46(7):613-22.
42	FDA Label of Osimertinib. The 2020 official website of the U.S. Food and Drug Administration.
43	Cytochrome P450 isozymes involved in lisofylline metabolism to pentoxifylline in human liver microsomes. Drug Metab Dispos. 1997 Dec;25(12):1354-8.
44	Perampanel (Fycompa): a review of clinical efficacy and safety in epilepsy. P T. 2016 Nov;41(11):683-698.
45	The roles of cytochrome P450 3A4 and 1A2 in the 3-hydroxylation of quinine in vivo. Clin Pharmacol Ther. 1999 Nov;66(5):454-60.
46	DailyMed : Alitretinoin
47	Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
48	Pharmacokinetic interactions study between carvedilol and some antidepressants in rat liver microsomes - a comparative study. Med Pharm Rep. 2019 Apr;92(2):158-164.
49	FDA Label of Deutetrabenazine. The 2020 official website of the U.S. Food and Drug Administration.
50	In vitro metabolism of zolmitriptan in rat cytochromes induced with beta-naphthoflavone and the interaction between six drugs and zolmitriptan. Chem Biol Interact. 2003 Dec 15;146(3):263-72.
51	The N-demethylation of the doxepin isomers is mainly catalyzed by the polymorphic CYP2C19. Pharm Res. 2002 Jul;19(7):1034-7.
52	Metabolism of the antiandrogenic drug (Flutamide) by human CYP1A2. Drug Metab Dispos. 1997 Nov;25(11):1298-303.
53	In vitro characterization of the metabolism of haloperidol using recombinant cytochrome p450 enzymes and human liver microsomes. Drug Metab Dispos. 2001 Dec;29(12):1638-43.
54	In?vitro assessment of the potential for dolutegravir to affect hepatic clearance of levonorgestrel
55	Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
56	Involvement of multiple cytochrome P450 isoforms in naproxen O-demethylation. Eur J Clin Pharmacol. 1997;52(4):293-8.
57	Drug Interactions Flockhart Table
58	Clinically significant psychotropic drug-drug interactions in the primary care setting. Curr Psychiatry Rep. 2012 Aug;14(4):376-90.
59	Effects of serotonin-3 receptor antagonists on cytochrome P450 activities in human liver microsomes. Biol Pharm Bull. 2006 Sep;29(9):1931-5.
60	Population pharmacokinetics of pomalidomide. J Clin Pharmacol. 2015 May;55(5):563-72.
61	Inhibitory effects of antiarrhythmic drugs on phenacetin O-deethylation catalysed by human CYP1A2. Br J Clin Pharmacol. 1998 Apr;45(4):361-8.
62	Rofecoxib is a potent inhibitor of cytochrome P450 1A2: studies with tizanidine and caffeine in healthy subjects. Br J Clin Pharmacol. 2006 Sep;62(3):345-57.
63	The effect of tocainide on theophylline metabolism. Br J Clin Pharmacol. 1993 Apr;35(4):437-40.
64	In Vitro Hepatic Oxidative Biotransformation of Trimethoprim Drug Metab Dispos. 2015 Sep;43(9):1372-80. doi: 10.1124/dmd.115.065193.
65	Identification of P450 enzymes involved in metabolism of verapamil in humans. Naunyn Schmiedebergs Arch Pharmacol. 1993 Sep;348(3):332-7.
66	The genetic profiles of CYP1A1, CYP1A2 and CYP2E1 enzymes as susceptibility factor in xenobiotic toxicity in Turkish population. Saudi Pharm J. 2017 Feb;25(2):294-297.
67	Metabolite Profiling and Reaction Phenotyping for the in Vitro Assessment of the Bioactivation of Bromfenac ? Chem Res Toxicol. 2020 Jan 21;33(1):249-257. doi: 10.1021/acs.chemrestox.9b00268.
68	Interactions between antiepileptics and second-generation antipsychotics. Expert Opin Drug Metab Toxicol. 2012 Mar;8(3):311-34.
69	Effects of CYP3A inhibition on the metabolism of cilostazol. Clin Pharmacokinet. 1999;37 Suppl 2:61-8.
70	Predominant role of peripheral catecholamines in the stress-induced modulation of CYP1A2 inducibility by benzo(alpha)pyrene. Basic Clin Pharmacol Toxicol. 2008 Jan;102(1):35-44.
71	CYP2B6 genotype-dependent inhibition of CYP1A2 and induction of CYP2A6 by the antiretroviral drug efavirenz in healthy volunteers. Clin Transl Sci. 2019 Nov;12(6):657-666.
72	Evidence for the Metabolic Activation of Deferasirox In Vitro and In Vivo
73	Reappraisal of human CYP isoforms involved in imipramine N-demethylation and 2-hydroxylation: a study using microsomes obtained from putative extensive and poor metabolizers of S-mephenytoin and eleven recombinant human CYPs. J Pharmacol Exp Ther. 1997 Jun;281(3):1199-210.
74	Contribution of UDP-glucuronosyltransferases 1A9 and 2B7 to the glucuronidation of indomethacin in the human liver. Eur J Clin Pharmacol. 2007 Mar;63(3):289-96.
75	Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
76	Resin haemoperfusion in levomepromazine poisoning: evaluation of effect on plasma drug and metabolite levels
77	Interactions between the cytochrome P450 system and the second-generation antipsychotics. J Psychiatry Neurosci. 2003 Mar;28(2):99-112.
78	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development Curr Med Chem. 2009;16(27):3480-675. doi: 10.2174/092986709789057635.
79	Association between CYP1A2 activity and riluzole clearance in patients with amyotrophic lateral sclerosis. Br J Clin Pharmacol. 2005 Mar;59(3):310-3.
80	Metabolism of ropivacaine in humans is mediated by CYP1A2 and to a minor extent by CYP3A4: an interaction study with fluvoxamine and ketoconazole as in vivo inhibitors. Clin Pharmacol Ther. 1998 Nov;64(5):484-91.
81	Rucaparib: the past, present, and future of a newly approved PARP inhibitor for ovarian cancer. Onco Targets Ther. 2017 Jun 19;10:3029-3037.
82	Adverse reactions to zolpidem: case reports and a review of the literature. Prim Care Companion J Clin Psychiatry. 2010;12(6). pii: PCC.09r00849.
83	Role of desethylamiodarone in the anticoagulant effect of concurrent amiodarone and warfarin therapy. J Cardiovasc Pharmacol Ther. 2001 Oct;6(4):363-7.
84	Addition of amoxapine improves positive and negative symptoms in a patient with schizophrenia Ther Adv Psychopharmacol. 2013 Dec;3(6):340-2. doi: 10.1177/2045125313499363.
85	Brassica vegetables increase and apiaceous vegetables decrease cytochrome P450 1A2 activity in humans: changes in caffeine metabolite ratios in response to controlled vegetable diets. Carcinogenesis. 2000 Jun;21(6):1157-62.
86	In vitro identification of the human cytochrome P-450 enzymes involved in the N-demethylation of azelastine. Drug Metab Dispos. 1999 Aug;27(8):942-6.
87	Pharmacokinetic and pharmacodynamic profile of bendamustine and its metabolites. Cancer Chemother Pharmacol. 2015 Jun;75(6):1143-54.
88	Functional polymorphisms of the cytochrome P450 1A2 (CYP1A2) gene and prolonged QTc interval in schizophrenia. Prog Neuropsychopharmacol Biol Psychiatry. 2007 Aug 15;31(6):1297-302.
89	Characterization of Clofazimine Metabolism in Human Liver Microsomal Incubation In Vitro
90	CYP2D6 mediates 4-hydroxylation of clonidine in vitro: implication for pregnancy-induced changes in clonidine clearance. Drug Metab Dispos. 2010 Sep;38(9):1393-6.
91	Metabolic drug interactions with newer antipsychotics: a comparative review. Basic Clin Pharmacol Toxicol. 2007 Jan;100(1):4-22.
92	Identification of human cytochrome p450 isozymes involved in diphenhydramine N-demethylation Drug Metab Dispos. 2007 Jan;35(1):72-8. doi: 10.1124/dmd.106.012088.
93	Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes Xenobiotica. 2003 Mar;33(3):265-76. doi: 10.1080/0049825021000061606.
94	In vitro metabolism of exemestane by hepatic cytochrome P450s: impact of nonsynonymous polymorphisms on formation of the active metabolite 17-dihydroexemestane Pharmacol Res Perspect. 2017 Apr 27;5(3):e00314. doi: 10.1002/prp2.314.
95	Frovatriptan: a review of drug-drug interactions. Headache. 2002 Apr;42 Suppl 2:S63-73.
96	Pharmacokinetics of levobupivacaine after caudal epidural administration in infants less than 3 months of age. Br J Anaesth. 2005 Oct;95(4):524-9.
97	In vitro identification of the human cytochrome p450 enzymes involved in the oxidative metabolism of loxapine. Biopharm Drug Dispos. 2011 Oct;32(7):398-407.
98	Malathion bioactivation in the human liver: the contribution of different cytochrome p450 isoforms. Drug Metab Dispos. 2005 Mar;33(3):295-302.
99	Impact of the CYP2D6 ultrarapid metabolizer genotype on mirtazapine pharmacokinetics and adverse events in healthy volunteers. J Clin Psychopharmacol. 2004 Dec;24(6):647-52.
100	CYP1A2 genetic polymorphisms are associated with treatment response to the antidepressant paroxetine. Pharmacogenomics. 2010 Nov;11(11):1535-43.
101	Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35.
102	Effect of antipsychotic drugs on human liver cytochrome P-450 (CYP) isoforms in vitro: preferential inhibition of CYP2D6. Drug Metab Dispos. 1999 Sep;27(9):1078-84.
103	Identification and characterization of human cytochrome P450 isoforms interacting with pimozide. J Pharmacol Exp Ther. 1998 May;285(2):428-37.
104	Novel Pathways of Ponatinib Disposition Catalyzed By CYP1A1 Involving Generation of Potentially Toxic Metabolites J Pharmacol Exp Ther. 2017 Oct;363(1):12-19. doi: 10.1124/jpet.117.243246.
105	ABCB1 and ABCG2, but not CYP3A4 limit oral availability and brain accumulation of the RET inhibitor pralsetinib
106	DrugBank(Pharmacology-Metabolism):Pralsetinib
107	Inhibition of cytochrome P450 2E1 by propofol in human and porcine liver microsomes. Biochem Pharmacol. 2002 Oct 1;64(7):1151-6.
108	Receptor-binding and pharmacokinetic properties of dopaminergic agonists. Curr Top Med Chem. 2008;8(12):1049-67.
109	Metabolism of sumatriptan revisited
110	Clinical assessment of drug-drug interactions of tasimelteon, a novel dual melatonin receptor agonist. J Clin Pharmacol. 2015 Sep;55(9):1004-11.
111	Association between common CYP1A2 polymorphisms and theophylline metabolism in non-smoking healthy volunteers. Basic Clin Pharmacol Toxicol. 2013 Apr;112(4):257-63.
112	Extraction of structure-activity relationship information from high-throughput screening data Curr Med Chem. 2009;16(31):4049-57. doi: 10.2174/092986709789378189.
113	Cytochrome P450-mediated metabolism of triclosan attenuates its cytotoxicity in hepatic cells
114	PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses. Pharmacogenet Genomics. 2015 Aug;25(8):416-26.
115	Apixaban. Hosp Pharm. 2013 Jun;48(6):494-509.
116	More methemoglobin is produced by benzocaine treatment than lidocaine treatment in human in vitro systems
117	FDA Label of Binimetinib. The 2020 official website of the U.S. Food and Drug Administration.
118	FDA Approved Drug Products: CIPRO XR (ciprofloxacin) extended-release tablets
119	Clinical pharmacokinetics and pharmacodynamics of dapagliflozin, a selective inhibitor of sodium-glucose co-transporter type 2. Clin Pharmacokinet. 2014 Jan;53(1):17-27.
120	Effects of morin on the pharmacokinetics of etoposide in rats. Biopharm Drug Dispos. 2007 Apr;28(3):151-6.
121	Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
122	Differential metabolism of gefitinib and erlotinib by human cytochrome P450 enzymes. Clin Cancer Res. 2007 Jun 15;13(12):3731-7.
123	PubChem:Grepafloxacin
124	Kinetic mechanism of the activation of human plasminogen by streptokinase. Biochemistry. 1975 Oct 7;14(20):4459-65.
125	The impact of individual human cytochrome P450 enzymes on oxidative metabolism of anticancer drug lenvatinib
126	N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
127	Cytochrome P450 enzymes contributing to demethylation of maprotiline in man. Pharmacol Toxicol. 2002 Mar;90(3):144-9.
128	Methadone--metabolism, pharmacokinetics and interactions. Pharmacol Res. 2004 Dec;50(6):551-9.
129	Lack of interaction between amiodarone and mexiletine in cardiac arrhythmia patients. J Clin Pharmacol. 2002 Mar;42(3):342-6.
130	Inhibition of human liver cytochrome P-450 1A2 by the class IB antiarrhythmics mexiletine, lidocaine, and tocainide. J Pharmacol Exp Ther. 1999 May;289(2):853-8.
131	The in vitro metabolism of desglymidodrine, an active metabolite of prodrug midodrine by human liver microsomes
132	Effects of olopatadine, a new antiallergic agent, on human liver microsomal cytochrome P450 activities Drug Metab Dispos. 2002 Dec;30(12):1504-11. doi: 10.1124/dmd.30.12.1504.
133	PharmGKB summary: very important pharmacogene information for CYP1A2. Pharmacogenet Genomics. 2012 Jan;22(1):73-7.
134	Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
135	Risk of clinically relevant pharmacokinetic-based drug-drug interactions with drugs approved by the U.S. Food and Drug Administration between 2013 and 2016. Drug Metab Dispos. 2018 Jun;46(6):835-845.
136	In vitro and in vivo evidence for the formation of methyl radical from procarbazine: a spin-trapping study. Carcinogenesis. 1992 May;13(5):799-805.
137	Comparative in vitro and in vivo inhibition of cytochrome P450 CYP1A2, CYP2D6, and CYP3A by H2-receptor antagonists. Clin Pharmacol Ther. 1999 Apr;65(4):369-76.
138	Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46.
139	Ontogeny and sorafenib metabolism. Clin Cancer Res. 2012 Oct 15;18(20):5788-95.
140	PubChem:Tapinarof
141	Timolol metabolism in human liver microsomes is mediated principally by CYP2D6. Drug Metab Dispos. 2007 Jul;35(7):1135-41.
142	Drug Interactions with Angiotensin Receptor Blockers: Role of Human Cytochromes P450
143	Lithium Intoxication in the Elderly: A Possible Interaction between Azilsartan, Fluvoxamine, and Lithium
144	Oxidative metabolism of flunarizine and cinnarizine by microsomes from B-lymphoblastoid cell lines expressing human cytochrome P450 enzymes. Biol Pharm Bull. 1996 Nov;19(11):1511-4.
145	Clinical pharmacokinetics and pharmacodynamics of clopidogrel. Clin Pharmacokinet. 2015 Feb;54(2):147-66.
146	Eltrombopag for use in children with immune thrombocytopenia. Blood Adv. 2018 Feb 27;2(4):454-461.
147	Flecainide: current status and perspectives in arrhythmia management. World J Cardiol. 2015 Feb 26;7(2):76-85.
148	LABEL:DDYI- flibanserin tablet, film coated
149	Disposition of fluvoxamine in humans is determined by the polymorphic CYP2D6 and also by the CYP1A2 activity
150	Heterogeneity in systemic availability of ondansetron and granisetron following oral administration. Drug Metab Dispos. 1999 Jan;27(1):110-2.
151	Evaluation of the effects of the weak CYP3A inhibitors atorvastatin and ethinyl estradiol/norgestimate on lomitapide pharmacokinetics in healthy subjects. J Clin Pharmacol. 2016 Jan;56(1):47-55.
152	Metabolism of loratadine and further characterization of its in vitro metabolites. Drug Metab Lett. 2009 Aug;3(3):162-70.
153	Comparison of (S)-mephenytoin and proguanil oxidation in vitro: contribution of several CYP isoforms. Br J Clin Pharmacol. 1999 Aug;48(2):158-67.
154	Inhibition of human cytochrome P450 enzymes by 1,4-dihydropyridine calcium antagonists: prediction of in vivo drug-drug interactions. Eur J Clin Pharmacol. 2000 Feb-Mar;55(11-12):843-52.
155	The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46.
156	Interaction of pefloxacin and enoxacin with the human cytochrome P450 enzyme CYP1A2
157	The metabolism of pyrazoloacridine (NSC 366140) by cytochromes p450 and flavin monooxygenase in human liver microsomes. Clin Cancer Res. 2004 Feb 15;10(4):1471-80.
158	Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102.
159	The selective serotonin reuptake inhibitor sertraline: its profile and use in psychiatric disorders. CNS Drug Rev. 2001 Spring;7(1):1-24.
160	Stiripentol. Expert Opin Investig Drugs. 2005 Jul;14(7):905-11.
161	Studies on the metabolism and biological activity of the epimers of sulindac
162	In vitro drug-drug interaction potential of sulfoxide and/or sulfone metabolites of albendazole, triclabendazole, aldicarb, methiocarb, montelukast and ziprasidone. Drug Metab Lett. 2018;12(2):101-116.
163	The clinical pharmacology and pharmacokinetics of ulipristal acetate for the treatment of uterine fibroids. Reprod Sci. 2015 Apr;22(4):476-83.
164	Open-label, dose-titration and continuation study to assess efficacy, safety, and pharmacokinetics of anagrelide in treatment-nae Japanese patients with essential thrombocythemia. Int J Hematol. 2013 Mar;97(3):360-8.
165	Cytochrome P450 isozymes responsible for the metabolism of toluene and styrene in human liver microsomes. Xenobiotica. 1997 Jul;27(7):657-65.
166	Principal drug-metabolizing enzyme systems in L1210 leukemia sensitive or resistant to BCNU in vivo. Leuk Res. 1994 Nov;18(11):829-35.
167	Metabolism and Interactions of Chloroquine and Hydroxychloroquine with Human Cytochrome P450 Enzymes and Drug Transporters Curr Drug Metab. 2020;21(14):1127-1135. doi: 10.2174/1389200221999201208211537.
168	Prediction of human liver microsomal oxidations of 7-ethoxycoumarin and chlorzoxazone with kinetic parameters of recombinant cytochrome P-450 enzymes. Drug Metab Dispos. 1999 Nov;27(11):1274-80.
169	Study on mesenchymal stem cells mediated enzyme-prodrug gene CYP1A2 targeting anti-tumor effect. Zhonghua Xue Ye Xue Za Zhi. 2009 Oct;30(10):667-71.
170	Effects of polyunsaturated fatty acids on prostaglandin synthesis and cyclooxygenase-mediated DNA adduct formation by heterocyclic aromatic amines in human adenocarcinoma colon cells. Mol Carcinog. 2004 Jul;40(3):180-8.
171	Species difference in stereoselective involvement of CYP3A in the mono-N-dealkylation of disopyramide. Xenobiotica. 2001 Feb;31(2):73-83.
172	FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
173	Comparative studies of in vitro inhibition of cytochrome P450 3A4-dependent testosterone 6beta-hydroxylation by roxithromycin and its metabolites, troleandomycin, and erythromycin. Drug Metab Dispos. 1998 Nov;26(11):1053-7.
174	Inhibitory potency of quinolone antibacterial agents against cytochrome P450IA2 activity in vivo and in vitro. Antimicrob Agents Chemother. 1992 May;36(5):942-8.
175	Hydroxylation and demethylation of the tricyclic antidepressant nortriptyline by cDNA-expressed human cytochrome P-450 isozymes. Drug Metab Dispos. 1997 Jun;25(6):740-4.
176	Effects of prototypical microsomal enzyme inducers on cytochrome P450 expression in cultured human hepatocytes. Drug Metab Dispos. 2003 Apr;31(4):421-31.
177	Effect of steady-state enoxacin on single-dose pharmacokinetics of roflumilast and roflumilast N-oxide. J Clin Pharmacol. 2011 Apr;51(4):586-93.
178	SULT 1A3 single-nucleotide polymorphism and the single dose pharmacokinetics of inhaled salbutamol enantiomers: are some athletes at risk of higher urine levels? Drug Test Anal. 2015 Feb;7(2):109-13. doi: 10.1002/dta.1645.
179	Rate-limiting biotransformation of triamterene is mediated by CYP1A2. Int J Clin Pharmacol Ther. 2005 Jul;43(7):327-34.
180	Management of Unique Populations with HCV Infection
181	DrugBank(Pharmacology-Metabolism):Voxilaprevir
182	Lack of effect of olanzapine on the pharmacokinetics of a single aminophylline dose in healthy men. Pharmacotherapy. 1998 Nov-Dec;18(6):1237-48.
183	Rat hepatic CYP1A1 and CYP1A2 induction by menadione. Toxicol Lett. 2005 Feb 15;155(2):253-8.
184	Identification of cytochrome P450 2E1 as the predominant enzyme catalyzing human liver microsomal defluorination of sevoflurane, isoflurane, and methoxyflurane. Anesthesiology. 1993 Oct;79(4):795-807.
185	Metabolism of ramelteon in human liver microsomes and correlation with the effect of fluvoxamine on ramelteon pharmacokinetics. Drug Metab Dispos. 2010 Aug;38(8):1381-91.
186	In vitro analysis of factors influencing CYP1A2 expression as potential determinants of interindividual variation. Pharmacol Res Perspect. 2017 Mar 2;5(2):e00299.
187	Psychotropic Medications Metabolized by Cytochromes P450 (CYP) 1A2 Enzyme and Relevant Drug Interactions: Review of Articles
188	Umbralisib: First Approval
189	Clinical pharmacology of lumiracoxib: a selective cyclo-oxygenase-2 inhibitor. Clin Pharmacokinet. 2005;44(12):1247-66.
190	CYP2D plays a major role in berberine metabolism in liver of mice and humans
191	Genetic variation in the first-pass metabolism of ethinylestradiol, sex hormone binding globulin levels and venous thrombosis risk Eur J Intern Med. 2017 Jul;42:54-60. doi: 10.1016/j.ejim.2017.05.019.
192	Metabolism of 17 alpha-ethinylestradiol by human liver microsomes in vitro: aromatic hydroxylation and irreversible protein binding of metabolites J Clin Endocrinol Metab. 1974 Dec;39(6):1072-80. doi: 10.1210/jcem-39-6-1072.
193	Insights into the substrate specificity, inhibitors, regulation, and polymorphisms and the clinical impact of human cytochrome P450 1A2. AAPS J. 2009 Sep;11(3):481-94.
194	No influence of the CYP2C19-selective inhibitor omeprazole on the pharmacokinetics of the dopamine receptor agonist rotigotine
195	Multiple P450 substrates in a single run: rapid and comprehensive in vitro interaction assay. Eur J Pharm Sci. 2005 Jan;24(1):123-32.
196	Identification of human cytochrome P450 isoforms involved in the stereoselective metabolism of mianserin enantiomers. J Pharmacol Exp Ther. 1996 Jul;278(1):21-30.
197	Identification of cytochrome P450 enzymes involved in the metabolism of zotepine, an antipsychotic drug, in human liver microsomes. Xenobiotica. 1999 Mar;29(3):217-29.
198	Appetite suppressant drugs as inhibitors of human cytochromes P450: in vitro inhibition of P450-2D6 by D- and L-fenfluramine, but not phentermine. J Clin Psychopharmacol. 1998 Aug;18(4):338-41.
199	Role of human liver cytochrome P4503A in the metabolism of etoricoxib, a novel cyclooxygenase-2 selective inhibitor. Drug Metab Dispos. 2001 Jun;29(6):813-20.
200	Pharmacokinetic evaluation of idebenone. Expert Opin Drug Metab Toxicol. 2010 Nov;6(11):1437-44.
201	CYP2A13 metabolizes the substrates of human CYP1A2, phenacetin, and theophylline. Drug Metab Dispos. 2007 Mar;35(3):335-9.
202	Mechanism-based inactivation of cytochrome P450s 1A2 and 3A4 by dihydralazine in human liver microsomes. Chem Res Toxicol. 1999 Oct;12(10):1028-32.
203	Perazine as a potent inhibitor of human CYP1A2 but not CYP3A4. Pol J Pharmacol. 2002 Jul-Aug;54(4):407-10.
204	Does celecoxib inhibit agomelatine metabolism via CYP2C9 or CYP1A2? Drug Des Devel Ther. 2018 Jul 11;12:2169-2172.
205	DrugBank(Pharmacology-Metabolism)Lofexidine
206	Ondansetron, ramosetron, or palonosetron: which is a better choice of antiemetic to prevent postoperative nausea and vomiting in patients undergoing laparoscopic cholecystectomy? Anesth Essays Res. 2011 Jul-Dec;5(2):182-6.
207	PharmGKB summary: caffeine pathway. Pharmacogenet Genomics. 2012 May;22(5):389-95.
208	Plasma protein binding, pharmacokinetics, tissue distribution and CYP450 biotransformation studies of fidarestat by ultra high performance liquid chromatography-high resolution mass spectrometry
209	Cytochrome P450 1A2 (CYP1A2) activity and risk factors for breast cancer: a cross-sectional study. Breast Cancer Res. 2004;6(4):R352-65.
210	Physiologically Based Pharmacokinetic Modeling for Selumetinib to Evaluate Drug-Drug Interactions and Pediatric Dose Regimens
211	Metabolism, Excretion, and Pharmacokinetics of Selumetinib, an MEK1/2 inhibitor, in Healthy Adult Male Subjects
212	Metabolic pathway of icotinib in vitro: the differential roles of CYP3A4, CYP3A5, and CYP1A2 on potential pharmacokinetic drug-drug interaction. J Pharm Sci. 2018 Apr;107(4):979-983.
213	DrugBank(Pharmacology-Metabolism):Chlorpromazine
214	In vitro metabolism of the analgesic bicifadine in the mouse, rat, monkey, and human. Drug Metab Dispos. 2007 Dec;35(12):2232-41.
215	Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
216	Carotenoids as regulators for inter-species difference in cytochrome P450 1A expression and activity in ungulates and rats. Food Chem Toxicol. 2010 Nov;48(11):3201-8.
217	Effect of ketoconazole on the pharmacokinetics of maribavir in healthy adults
218	Preclinical metabolism and disposition of SB939 (Pracinostat), an orally active histone deacetylase inhibitor, and prediction of human pharmacokinetics. Drug Metab Dispos. 2011 Dec;39(12):2219-32.
219	DrugBank(Pharmacology-Metabolism):BMS-986165
220	Identification of the oxidative and conjugative enzymes involved in the biotransformation of brivanib
221	Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
222	Cytochrome P450 isoform selectivity in human hepatic theobromine metabolism. Br J Clin Pharmacol. 1999 Mar;47(3):299-305.
223	Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
224	Involvement of cytochrome P450 1A2 in the biotransformation of trans-resveratrol in human liver microsomes. Biochem Pharmacol. 2004 Aug 15;68(4):773-82.
225	In vitro evaluation of fenfluramine and norfenfluramine as victims of drug interactions
226	DrugBank(Pharmacology-Metabolism):MRTX849
227	DrugBank(Pharmacology-Metabolism):Ag-221
228	Pharmacokinetics and disposition of momelotinib revealed a disproportionate human metabolite-resolution for clinical development. Drug Metab Dispos. 2018 Mar;46(3):237-247.
229	Psychological effects of dopamine agonist treatment in patients with hyperprolactinemia and prolactin-secreting adenomas. Eur J Endocrinol. 2019 Jan 1;180(1):31-40.
230	DrugBank(Pharmacology-Metabolism):Verapamil
231	In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
232	Determination of an optimal dosing regimen for fexinidazole, a novel oral drug for the treatment of human African trypanosomiasis: first-in-human studies
233	Fexinidazole--a new oral nitroimidazole drug candidate entering clinical development for the treatment of sleeping sickness. PLoS Negl Trop Dis. 2010 Dec 21;4(12):e923.
234	CYP3A but not P-gp plays a relevant role in the in vivo intestinal and hepatic clearance of the delta-specific phosphoinositide-3 kinase inhibitor leniolisib
235	Differential mechanisms for the inhibition of human cytochrome P450 1A2 by apigenin and genistein. J Biochem Mol Toxicol. 2010 Jul-Aug;24(4):230-4.
236	KAE609 (Cipargamin), a New Spiroindolone Agent for the Treatment of Malaria: Evaluation of the Absorption, Distribution, Metabolism, and Excretion of a Single Oral 300-mg Dose of [14C]KAE609 in Healthy Male Subjects
237	A drug-drug interaction study to assess the effect of the CYP1A2 inhibitor fluvoxamine on the pharmacokinetics of dovitinib (TKI258) in patients with advanced solid tumors. Cancer Chemother Pharmacol. 2018 Jan;81(1):73-80.
238	Metabolic Profiling of the Novel Hypoxia-Inducible Factor 2 Inhibitor PT2385 In Vivo and In Vitro
239	Metabolism and disposition of vatalanib (PTK787/ZK-222584) in cancer patients
240	Vatalanib population pharmacokinetics in patients with myelodysplastic syndrome: CALGB 10105 (Alliance)
241	Acetaminophen activation by human liver cytochromes P450IIE1 and P450IA2. Arch Biochem Biophys. 1989 Jun;271(2):270-83.
242	In vitro evaluation of the metabolic enzymes and drug interaction potential of triapine
243	Effect of deuteration on metabolism and clearance of Nerispirdine (HP184) and AVE5638
244	Cytochrome P450 Mediated Bioactivation of Saracatinib
245	Identification of metabolic pathways involved in the biotransformation of tolperisone by human microsomal enzymes. Drug Metab Dispos. 2003 May;31(5):631-6.
246	Integration of Physiologically-Based Pharmacokinetic Modeling into Early Clinical Development: An Investigation of the Pharmacokinetic Nonlinearity
247	Anti-inflammatory effects of ladostigil and its metabolites in aged rat brain and in microglial cells
248	Characterization of human cytochrome P450 isoenzymes involved in the metabolism of vinorelbine. Fundam Clin Pharmacol. 2005 Oct;19(5):545-53.
249	Metabolic pathways of the camptothecin analog AR-67
250	Preclinical factors affecting the interindividual variability in the clearance of the investigational anti-cancer drug 5,6-dimethylxanthenone-4-acetic acid. Biochem Pharmacol. 2003 Jun 1;65(11):1853-65.
251	Physiologically based modeling of lisofylline pharmacokinetics following intravenous administration in mice. Eur J Drug Metab Pharmacokinet. 2016 Aug;41(4):403-12.
252	Metabolism and disposition of GTS-21, a novel drug for Alzheimer's disease. Xenobiotica. 1999 Jul;29(7):747-62.
253	Beta-adrenergic receptor modulation of the LPS-mediated depression in CYP1A activity in astrocytes. Biochem Pharmacol. 2005 Mar 1;69(5):741-50.
254	Isolation, Structural Identification, Synthesis, and Pharmacological Profiling of 1,2-trans-Dihydro-1,2-diol Metabolites of the Utrophin Modulator Ezutromid
255	Phase I clinical trial of MPC-6827 (Azixa), a microtubule destabilizing agent, in patients with advanced cancer
256	Phase Ia/b, Open-Label, Multicenter Study of AZD4635 (an Adenosine A2A Receptor Antagonist) as Monotherapy or Combined with Durvalumab, in Patients with Solid Tumors
257	Evaluation of the drug-drug interaction potential for trazpiroben (TAK-906), a D(2)/D(3) receptor antagonist for gastroparesis, towards cytochrome P450s and transporters
258	Discovery of Encequidar, First-in-Class Intestine Specific P-glycoprotein Inhibitor
259	Review of Clinically Relevant Drug Interactions with Next Generation Hepatitis C Direct-acting Antiviral Agents
260	The Potential Role of POR28 and CYP1A2F Genetic Variations and Lifestyle Factors on Clozapine and N-DesmethylClozapine Plasma Levels in Schizophrenia Patients
261	Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706.
262	Metabolic map and bioactivation of the anti-tumour drug noscapine
263	GABA(A) receptor activity modulating piperine analogs: In vitro metabolic stability, metabolite identification, CYP450 reaction phenotyping, and protein binding
264	Characterization of cytochrome P450s mediating ipriflavone metabolism in human liver microsomes. Xenobiotica. 2007 Mar;37(3):246-59.
265	Preclinical metabolism and pharmacokinetics of SB1317 (TG02), a potent CDK/JAK2/FLT3 inhibitor. Drug Metab Lett. 2012 Mar;6(1):33-42.
266	Metabolism and pharmacokinetics of allitinib in cancer patients: the roles of cytochrome P450s and epoxide hydrolase in its biotransformation
267	Pharmacokinetics and Metabolism of Naringin and Active Metabolite Naringenin in Rats, Dogs, Humans, and the Differences Between Species
268	Comparative Metabolism of Batracylin (NSC 320846) and N-acetylbatracylin (NSC 611001) Using Human, Dog, and Rat Preparations In Vitro
269	Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
270	In vitro metabolism of 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin in human liver microsomes
271	Rapid determination of five probe drugs and their metabolites in human plasma and urine by liquid chromatography/tandem mass spectrometry: application to cytochrome P450 phenotyping studies. Rapid Commun Mass Spectrom. 2004;18(23):2921-33.
272	MLN8054 and Alisertib (MLN8237): discovery of selective oral aurora A inhibitors. ACS Med Chem Lett. 2015 Apr 22;6(6):630-4.
273	Drug-Drug Interaction Study to Assess the Effect of Cytochrome P450 Inhibition and Induction on the Pharmacokinetics of the Novel Cereblon Modulator Avadomide (CC-122) in Healthy Adult Subjects
274	Cilomilast: a second generation phosphodiesterase 4 inhibitor for asthma and chronic obstructive pulmonary disease
275	An assessment of human liver-derived in vitro systems to predict the in vivo metabolism and clearance of almokalant
276	[Investigation of metabolic kinetics and reaction phenotyping of ligustrazin by using liver microsomes and recombinant human enzymes]
277	Identification of cytochrome P450 isoform involved in the metabolism of YM992, a novel selective serotonin re-uptake inhibitor, in human liver microsomes
278	Behavior of thymidylate kinase toward monophosphate metabolites and its role in the metabolism of 1-(2'-deoxy-2'-fluoro-beta-L-arabinofuranosyl)-5-methyluracil (Clevudine) and 2',3'-didehydro-2',3'-dideoxythymidine in cells. Antimicrob Agents Chemother. 2005 May;49(5):2044-9. doi: 10.1128/AAC.49.5.2044-2049.2005.
279	Species-dependent metabolism of a novel selective 7 neuronal acetylcholine receptor agonist ABT-107
280	In-vitro metabolism of YM17E, an inhibitor of acyl coenzyme A:cholesterol acyltransferase, by liver microsomes in man
281	In vitro metabolism studies of nomifensine monooxygenation pathways: metabolite identification, reaction phenotyping, and bioactivation mechanism
282	Human biotransformation of bropirimine. Characterization of the major bropirimine oxidative metabolites formed in vitro. Drug Metab Dispos. 1998 Oct;26(10):1048-51.
283	Metabolism of mofarotene in hepatocytes and liver microsomes from different species. Comparison with in vivo data and evaluation of the cytochrome P450 isoenzymes involved in human biotransformation. Drug Metab Dispos. 1995 Oct;23(10):1051-7.
284	Effects of cytokine-induced macrophages on the response of tumor cells to banoxantrone (AQ4N)
285	Bioreductively activated antitumor N-oxides: the case of AQ4N, a unique approach to hypoxia-activated cancer chemotherapy
286	CYP2S1 is negatively regulated by corticosteroids in human cell lines. Toxicol Lett. 2012 Feb 25;209(1):30-4.
287	Antidepressants: Past, Present and Future. Edited by Sheldon H. Preskorn Christina Y. Stanga John P. Feighner Ruth Ross. Page: 574.
288	Using chimeric mice with humanized livers to predict human drug metabolism and a drug-drug interaction. J Pharmacol Exp Ther. 2013 Feb;344(2):388-96.
289	Cytochrome P450 isozymes involved in propranolol metabolism in human liver microsomes. The role of CYP2D6 as ring-hydroxylase and CYP1A2 as N-desisopropylase. Drug Metab Dispos. 1994 Nov-Dec;22(6):909-15.
290	Identification of the cytochromes P450 that catalyze coumarin 3,4-epoxidation and 3-hydroxylation
291	The influence of the sparteine/debrisoquine genetic polymorphism on the disposition of dexfenfluramine. Br J Clin Pharmacol. 1996 Apr;41(4):311-7.
292	Carcinogenic 3-nitrobenzanthrone but not 2-nitrobenzanthrone is metabolised to an unusual mercapturic acid in rats
293	Urinary metabolites of dibutyl phthalate and benzophenone-3 are potential chemical risk factors of chronic kidney function markers among healthy women
294	Bufuralol hydroxylation by cytochrome P450 2D6 and 1A2 enzymes in human liver microsomes
295	Selective serotonin reuptake inhibitors and CNS drug interactions. A critical review of the evidence. Clin Pharmacokinet. 1997 Dec;33(6):454-71.
296	In Vitro Regio- and Stereoselective Oxidation of -Ionone by Human Liver Microsomes
297	Role of polymorphic human cytochrome P450 enzymes in estrone oxidation. Cancer Epidemiol Biomarkers Prev. 2006 Mar;15(3):551-8.
298	In vitro investigation of cytochrome P450-mediated metabolism of dietary flavonoids. Food Chem Toxicol. 2002 May;40(5):609-16.
299	Major pathway of imipramine metabolism is catalyzed by cytochromes P-450 1A2 and P-450 3A4 in human liver. Mol Pharmacol. 1993 May;43(5):827-32.
300	Cytochrome P450 4A11 inhibition assays based on characterization of lauric acid metabolites
301	Activation of the antitumor agent aminoflavone (NSC 686288) is mediated by induction of tumor cell cytochrome P450 1A1/1A2. Mol Pharmacol. 2002 Jul;62(1):143-53.
302	Characterization of human cytochrome P450 enzymes involved in the metabolism of cyamemazine. Eur J Pharm Sci. 2007 Dec;32(4-5):357-66.
303	Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.
304	Human liver oxidative metabolism of O6-benzylguanine. Biochem Pharmacol. 1995 Oct 26;50(9):1385-9.
305	Coleman J., Cox A. and Cowley N. (2011). Side Effects of Drugs Annual. Elsevier.
306	Acetaminophen, via its reactive metabolite N-acetyl-p-benzo-quinoneimine and transient receptor potential ankyrin-1 stimulation, causes neurogenic inflammation in the airways and other tissues in rodents FASEB J. 2010 Dec;24(12):4904-16. doi: 10.1096/fj.10-162438.
307	Rapid detection and quantification of paracetamol and its major metabolites using surface enhanced Raman scattering. Analyst. 2023 Apr 11;148(8):1805-1814. doi: 10.1039/d3an00249g.
308	Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
309	Clinical pharmacokinetics of almotriptan, a serotonin 5-HT(1B/1D) receptor agonist for the treatment of migraine. Clin Pharmacokinet. 2005;44(3):237-46.
310	Cytochromes P450: a structure-based summary of biotransformations using representative substrates Drug Metab Rev. 2008;40(1):1-100. doi: 10.1080/03602530802309742.
311	Addition of amoxapine improves positive and negative symptoms in a patient with schizophrenia. Ther Adv Psychopharmacol. 2013 Dec;3(6):340-2.
312	DrugBank(Pharmacology-Metabolism)Amoxapine
313	DrugBank(Pharmacology-Metabolism)Anagrelide hydrochloride
314	Colorimetric detection of human caeruloplasmin oxidase activity after electrophoresis in agar plates or after immunoelectrophoresis. Nature. 1958 Apr 5;181(4614):999-1000. doi: 10.1038/181999b0.
315	Apixaban. After hip or knee replacement: LMWH remains the standard treatment. Prescrire Int. 2012 Sep;21(130):201-2, 204.
316	Disposition, metabolism and mass balance of [(14)C]apremilast following oral administration. Xenobiotica. 2011 Dec;41(12):1063-75.
317	Lack of effect of aprepitant on the pharmacokinetics of docetaxel in cancer patients. Cancer Chemother Pharmacol. 2005 Jun;55(6):609-16.
318	Role of cytochrome P450 enzymes in the bioactivation of polyunsaturated fatty acids. Biochim Biophys Acta. 2011 Jan;1814(1):210-22.
319	Predicting pharmacokinetics and drug interactions in patients from in vitro and in vivo models: the experience with 5,6-dimethylxanthenone-4-acetic acid (DMXAA), an anti-cancer drug eliminated mainly by conjugation. Drug Metab Rev. 2002 Nov;34(4):751-90.
320	In Vitro Kinetic Characterization of Axitinib Metabolism
321	The metabolism of berberine and its contribution to the pharmacological effects
322	Transformation of berberine to its demethylated metabolites by the CYP51 enzyme in the gut microbiota
323	LABEL: JUXTAPID- lomitapide mesylate capsule
324	The effect of itraconazole on the pharmacokinetics and pharmacodynamics of bromazepam in healthy volunteers
325	Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
326	Metabolic disposition of 14C-bromfenac in healthy male volunteers J Clin Pharmacol. 1998 Aug;38(8):744-52. doi: 10.1002/j.1552-4604.1998.tb04815.x.
327	Role of CYP3A in bromperidol metabolism in rat in vitro and in vivo Xenobiotica. 1999 Aug;29(8):839-46. doi: 10.1080/004982599238281.
328	Urine caffeine metabolites are positively associated with cognitive performance in older adults: An analysis of US National Health and Nutrition Examination Survey (NHANES) 2011 to 2014. Nutr Res. 2023 Jan;109:12-25. doi: 10.1016/j.nutres.2022.11.002.
329	Pharmacokinetic analysis and comparison of caffeine administered rapidly or slowly in coffee chilled or hot versus chilled energy drink in healthy young adults Clin Toxicol (Phila). 2016;54(4):308-12. doi: 10.3109/15563650.2016.1146740.
330	In vivo evaluation of CYP1A2, CYP2A6, NAT-2 and xanthine oxidase activities in a Greek population sample by the RP-HPLC monitoring of caffeine metabolic ratios Biomed Chromatogr. 2007 Feb;21(2):190-200. doi: 10.1002/bmc.736.
331	Metabolism of carvedilol in dogs, rats, and mice Drug Metab Dispos. 1998 Oct;26(10):958-69.
332	Cytochromes P450 and experimental models of drug metabolism. J Cell Mol Med. 2002 Apr-Jun;6(2):189-98.
333	Antiserotonergic properties of terguride in blood vessels, platelets, and valvular interstitial cells
334	Classics in Chemical Neuroscience: Chlorpromazine ACS Chem Neurosci. 2019 Jan 16;10(1):79-88. doi: 10.1021/acschemneuro.8b00258.
335	Determination of chlorpromazine and its metabolites in animal-derived foods using QuEChERS-based extraction, EMR-Lipid cleanup, and UHPLC-Q-Orbitrap MS analysis. Food Chem. 2023 Mar 1;403:134298. doi: 10.1016/j.foodchem.2022.134298.
336	DrugBank : Cinnarizine
337	Pharmacogenomics knowledge for personalized medicine Clin Pharmacol Ther. 2012 Oct;92(4):414-7. doi: 10.1038/clpt.2012.96.
338	Metabolism of clomipramine in a Japanese psychiatric population: hydroxylation, desmethylation, and glucuronidation
339	Population pharmacokinetics of clomipramine, desmethylclomipramine, and hydroxylated metabolites in patients with depression receiving chronic treatment: model evaluation
340	Species differences and interindividual variation in liver microsomal cytochrome P450 2A enzymes: effects on coumarin, dicumarol, and testosterone oxidation
341	In vitro metabolism of CP-122,721 ((2S,3S)-2-phenyl-3-[(5-trifluoromethoxy-2-methoxy)benzylamino]piperidine), a non-peptide antagonist of the substance P receptor. Drug Metab Pharmacokinet. 2007 Oct;22(5):336-49.
342	Metabolism, pharmacokinetics, and excretion of the substance P receptor antagonist CP-122,721 in humans: structural characterization of the novel major circulating metabolite 5-trifluoromethoxy salicylic acid by high-performance liquid chromatography-tandem mass spectrometry and NMR spectroscopy
343	Active cyamemazine metabolites in patients treated with cyamemazine (Tercian?): influence on cerebral dopamine D2 and serotonin 5-HT (2A) receptor occupancy as measured by positron emission tomography (PET)
344	Pharmacokinetics of dacarbazine (DTIC) in pregnancy
345	In vitro characterization and pharmacokinetics of dapagliflozin (BMS-512148), a potent sodium-glucose cotransporter type II inhibitor, in animals and humans Drug Metab Dispos. 2010 Mar;38(3):405-14. doi: 10.1124/dmd.109.029165.
346	Metabolism of dexfenfluramine in human liver microsomes and by recombinant enzymes: role of CYP2D6 and 1A2. Pharmacogenetics. 1998 Oct;8(5):423-32.
347	DrugBank(Pharmacology-Metabolism)Diazepam
348	Pharmacokinetics of Diazepam and Its Metabolites in Urine of Chinese Participants. Drugs R D. 2022 Mar;22(1):43-50. doi: 10.1007/s40268-021-00375-y.
349	Kinetic disposition of diazepam and its metabolites after intravenous administration of diazepam in the horse: Relevance for doping control. J Vet Pharmacol Ther. 2021 Sep;44(5):733-744. doi: 10.1111/jvp.12991.
350	Plasma and synovial fluid concentrations of diclofenac sodium and its major hydroxylated metabolites during long-term treatment of rheumatoid arthritis Eur J Clin Pharmacol. 1983;25(3):389-94. doi: 10.1007/BF01037953.
351	Simultaneous determination of diclofenac sodium and its hydroxy metabolites by capillary column gas chromatography with electron-capture detection J Chromatogr. 1981 Nov 6;217:263-71. doi: 10.1016/s0021-9673(00)88081-4.
352	Identification of human cytochrome p450 isozymes involved in diphenhydramine N-demethylation. Drug Metab Dispos. 2007 Jan;35(1):72-8.
353	Bioconcentration, metabolism and effects of diphenhydramine on behavioral and biochemical markers in crucian carp (Carassius auratus) Sci Total Environ. 2016 Feb 15;544:400-9. doi: 10.1016/j.scitotenv.2015.11.132.
354	Non-invasive skin sampling detects systemically administered drugs in humans. PLoS One. 2022 Jul 26;17(7):e0271794. doi: 10.1371/journal.pone.0271794.
355	Characterization of human cytochrome P450 enzymes involved in the biotransformation of eperisone. Xenobiotica. 2009 Jan;39(1):1-10.
356	DrugBank(Pharmacology-Metabolism)Estradiol acetate
357	Cytochrome P450-mediated metabolism of estrogens and its regulation in human. Cancer Lett. 2005 Sep 28;227(2):115-24.
358	Induction of CYP3A4 by efavirenz in primary human hepatocytes: comparison with rifampin and phenobarbital. J Clin Pharmacol. 2004 Nov;44(11):1273-81.
359	Biotransformation of Efavirenz and Proteomic Analysis of Cytochrome P450s and UDP-Glucuronosyltransferases in Mouse, Macaque, and Human Brain-Derived In Vitro Systems. Drug Metab Dispos. 2023 Apr;51(4):521-531. doi: 10.1124/dmd.122.001195.
360	Liver Cirrhosis Affects the Pharmacokinetics of the Six Substrates of the Basel?Phenotyping Cocktail Differently. Clin Pharmacokinet. 2022 Jul;61(7):1039-1055. doi: 10.1007/s40262-022-01119-0.
361	Instability of Efavirenz Metabolites Identified During Method Development and Validation. J Pharm Sci. 2021 Oct;110(10):3362-3366. doi: 10.1016/j.xphs.2021.06.028.
362	Bioactivity and metabolism of trans-resveratrol orally administered to Wistar rats
363	FDA:Enasidenib
364	The metabolism of estradiol; oral compared to intravenous administration J Steroid Biochem. 1985 Dec;23(6A):1065-70. doi: 10.1016/0022-4731(85)90068-8.
365	Sulfotransferase 1E1 is a low km isoform mediating the 3-O-sulfation of ethinyl estradiol Drug Metab Dispos. 2004 Nov;32(11):1299-303. doi: 10.1124/dmd.32.11..
366	Absorption, metabolism, and excretion of etoricoxib, a potent and selective cyclooxygenase-2 inhibitor, in healthy male volunteers
367	In vitro metabolism of exemestane by hepatic cytochrome P450s: impact of nonsynonymous polymorphisms on formation of the active metabolite 17beta-dihydroexemestane. Pharmacol Res Perspect. 2017 Apr 27;5(3):e00314.
368	Inhibition of the aromatase enzyme by exemestane cysteine conjugates. Mol Pharmacol. 2022 Aug 11;102(5):216-22. doi: 10.1124/molpharm.122.000545.
369	Influence of Glutathione-S-Transferase A1*B Allele on the Metabolism of the Aromatase Inhibitor, Exemestane, in Human Liver Cytosols and in Patients Treated With Exemestane. J Pharmacol Exp Ther. 2022 Sep;382(3):327-334. doi: 10.1124/jpet.122.001232.
370	In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition. Xenobiotica. 2008 May;38(5):496-510.
371	U. S. FDA Label -Fenfluramine
372	Effects of CYP2D6 genotypes on age-related change of flecainide metabolism: involvement of CYP1A2-mediated metabolism. Br J Clin Pharmacol. 2009 Jul;68(1):89-96.
373	(R)-, (S)-, and racemic fluoxetine N-demethylation by human cytochrome P450 enzymes. Drug Metab Dispos. 2000 Oct;28(10):1187-91.
374	Simultaneous identification and quantitation of fluoxetine and its metabolite, norfluoxetine, in biological samples by GC-MS
375	DrugBank(Pharmacology-Metabolism):Flutamide
376	DrugBank(Pharmacology-Metabolism):Fluvoxamine
377	DrugBank(Pharmacology-Metabolism)Fluvoxamine maleate
378	DrugBank(Pharmacology-Metabolism)Frovatriptan
379	DrugBank(Pharmacology-Metabolism):Guanabenz
380	DrugBank(Pharmacology-Metabolism):Haloperidol decanoate
381	DrugBank(Pharmacology-Metabolism):Hesperetin
382	Role of cytochrome P450 activity in the fate of anticancer agents and in drug resistance: focus on tamoxifen, paclitaxel and imatinib metabolism
383	Participation of CYP2C8 and CYP3A4 in the N-demethylation of imatinib in human hepatic microsomes
384	In vitro biotransformation of imatinib by the tumor expressed CYP1A1 and CYP1B1
385	Eight inhibitory monoclonal antibodies define the role of individual P-450s in human liver microsomal diazepam, 7-ethoxycoumarin, and imipramine metabolism. Drug Metab Dispos. 1999 Jan;27(1):102-9.
386	Imipramine metabolites in blood of patients during therapy and after overdose
387	Deletion of the mouse Fmo1 gene results in enhanced pharmacological behavioural responses to imipramine
388	Roles of UGT, P450, and Gut Microbiota in the Metabolism of Epacadostat in Humans
389	In vitro metabolism of indiplon and an assessment of its drug interaction potential
390	In vitro metabolism of leflunomide by mouse and human liver microsomes Drug Metab Lett. 2007 Dec;1(4):299-305. doi: 10.2174/187231207783221402.
391	In vitro metabolism studies on the isoxazole ring scission in the anti-inflammatory agent lefluonomide to its active alpha-cyanoenol metabolite A771726: mechanistic similarities with the cytochrome P450-catalyzed dehydration of aldoximes Drug Metab Dispos. 2003 Oct;31(10):1240-50. doi: 10.1124/dmd.31.10.1240.
392	Clinical profile of levobupivacaine in regional anesthesia: A systematic review. J Anaesthesiol Clin Pharmacol. 2013 Oct;29(4):530-9.
393	The Use and Method of Action of Intravenous Lidocaine and Its Metabolite in Headache Disorders Headache. 2018 May;58(5):783-789. doi: 10.1111/head.13298.
394	Involvement of CYP1A2 and CYP3A4 in lidocaine N-deethylation and 3-hydroxylation in humans. Drug Metab Dispos. 2000 Aug;28(8):959-65.
395	Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
396	Effects of cytochrome P450 single nucleotide polymorphisms on methadone metabolism and pharmacodynamics
397	Identification of novel metoclopramide metabolites in humans: in vitro and in vivo studies
398	Involvement of CYP1A2 in mexiletine metabolism. Br J Clin Pharmacol. 1998 Jul;46(1):55-62.
399	Clinical pharmacokinetics of mirtazapine
400	Safety assessment, in vitro and in vivo, and pharmacokinetics of emivirine, a potent and selective nonnucleoside reverse transcriptase inhibitor of human immunodeficiency virus type 1. Antimicrob Agents Chemother. 2000 Jan;44(1):123-30.
401	DrugBank(Pharmacology-Metabolism):Adagrasib
402	Clinical pharmacokinetics of nabumetone. The dawn of selective cyclo-oxygenase-2 inhibition?
403	Identification of human cytochrome P450 isozymes involved in the metabolism of naftopidil enantiomers in vitro. J Pharm Pharmacol. 2014 Nov;66(11):1534-51.
404	Characterization of Ca(2+)-antagonistic effects of three metabolites of the new antihypertensive agent naftopidil, (naphthyl)hydroxy-naftopidil, (phenyl)hydroxy-naftopidil, and O-desmethyl-naftopidil J Cardiovasc Pharmacol. 1991 Dec;18(6):918-25. doi: 10.1097/00005344-199112000-00020.
405	S-Naproxen and desmethylnaproxen glucuronidation by human liver microsomes and recombinant human UDP-glucuronosyltransferases (UGT): role of UGT2B7 in the elimination of naproxen. Br J Clin Pharmacol. 2005 Oct;60(4):423-33.
406	[Pharmacokinetics of phenazone after bilateral ovariectomy in female rabbits]
407	Absorption, disposition, metabolic fate, and elimination of the dopamine agonist rotigotine in man: administration by intravenous infusion or transdermal delivery
408	Inhibitory effects of nicardipine to cytochrome P450 (CYP) in human liver microsomes. Biol Pharm Bull. 2005 May;28(5):882-5.
409	Metabolism of the anthelmintic drug niclosamide by cytochrome P450 enzymes and UDP-glucuronosyltransferases: metabolite elucidation and main contributions from CYP1A2 and UGT1A1 Xenobiotica. 2016;46(1):1-13. doi: 10.3109/00498254.2015.1047812.
410	Neutrophil- and myeloperoxidase-mediated metabolism of reduced nimesulide: evidence for bioactivation Chem Res Toxicol. 2010 Nov 15;23(11):1691-700. doi: 10.1021/tx1001496.
411	Activation of 3-nitrobenzanthrone and its metabolites by human acetyltransferases, sulfotransferases and cytochrome P450 expressed in Chinese hamster V79 cells
412	Quantitative Modeling Analysis Demonstrates the Impact of CYP2C19 and CYP2D6 Genetic Polymorphisms on the Pharmacokinetics of Amitriptyline and Its Metabolite, Nortriptyline J Clin Pharmacol. 2019 Apr;59(4):532-540. doi: 10.1002/jcph.1344.
413	DrugBank(Pharmacology-Metabolism)Nortriptyline hydrochloride
414	Role of cytochrome P450 isoenzymes in metabolism of O(6)-benzylguanine: implications for dacarbazine activation. Clin Cancer Res. 2001 Dec;7(12):4239-44.
415	Olanzapine. Pharmacokinetic and pharmacodynamic profile. Clin Pharmacokinet. 1999 Sep;37(3):177-93.
416	The Unique Human N10-Glucuronidated Metabolite Formation from Olanzapine in Chimeric NOG-TKm30 Mice with Humanized Livers. Drug Metab Dispos. 2023 Apr;51(4):480-491. doi: 10.1124/dmd.122.001102.
417	Identification of novel ondansetron metabolites using LC/MS(n) and NMR J Chromatogr B Analyt Technol Biomed Life Sci. 2018 Sep 15;1095:138-141. doi: 10.1016/j.jchromb.2018.07.013.
418	Polymorphisms in the CYP1A2 gene and theophylline metabolism in patients with asthma Clin Pharmacol Ther. 2003 May;73(5):468-74. doi: 10.1016/s0009-9236(03)00013-4.
419	Identification of cytochrome P450 isoforms involved in the metabolism of paroxetine and estimation of their importance for human paroxetine metabolism using a population-based simulator. Drug Metab Dispos. 2010 Mar;38(3):376-85.
420	Pazopanib: the newest tyrosine kinase inhibitor for the treatment of advanced or metastatic renal cell carcinoma. Drugs. 2011 Mar 5;71(4):443-54.
421	Bioavailability, metabolism and disposition of oral pazopanib in patients with advanced cancer Xenobiotica. 2013 May;43(5):443-53. doi: 10.3109/00498254.2012.734642.
422	Metabolism of lisofylline and pentoxifylline in human liver microsomes and cytosol Drug Metab Dispos. 1996 Nov;24(11):1174-9.
423	Role of CYP1A2 and CYP2E1 in the pentoxifylline ciprofloxacin drug interaction Biochem Pharmacol. 2004 Jul 15;68(2):395-402. doi: 10.1016/j.bcp.2004.03.035.
424	The metabolism of the piperazine-type phenothiazine neuroleptic perazine by the human cytochrome P-450 isoenzymes. Eur Neuropsychopharmacol. 2004 May;14(3):199-208.
425	Anti-Parkinson's disease drugs and pharmacogenetic considerations Expert Opin Drug Metab Toxicol. 2013 Jul;9(7):859-74. doi: 10.1517/17425255.2013.789018.
426	DrugBank(Pharmacology-Metabolism)Phenacetin
427	The Respective Roles of CYP3A4 and CYP2D6 in the Metabolism of Pimozide to Established and Novel Metabolites Drug Metab Dispos. 2020 Nov;48(11):1113-1120. doi: 10.1124/dmd.120.000188.
428	Pharmacokinetic evaluation of tissue distribution of pirfenidone and its metabolites for idiopathic pulmonary fibrosis therapy Biopharm Drug Dispos. 2015 May;36(4):205-15. doi: 10.1002/bdd.1932.
429	Pharmacokinetic and pharmacometabolomic study of pirfenidone in normal mouse tissues using high mass resolution MALDI-FTICR-mass spectrometry imaging Histochem Cell Biol. 2016 Feb;145(2):201-11. doi: 10.1007/s00418-015-1382-7.
430	Pharmacokinetics and metabolism of intravenous pirfenidone in sheep Biopharm Drug Dispos. 2008 Mar;29(2):119-26. doi: 10.1002/bdd.595.
431	Absorption, metabolism and excretion of [14C]pomalidomide in humans following oral administration Cancer Chemother Pharmacol. 2013 Feb;71(2):489-501. doi: 10.1007/s00280-012-2040-6.
432	Pomalidomide: evaluation of cytochrome P450 and transporter-mediated drug-drug interaction potential in vitro and in healthy subjects. J Clin Pharmacol. 2015 Feb;55(2):168-78.
433	Metabolic profiles of pomalidomide in human plasma simulated with pharmacokinetic data in control and humanized-liver mice Xenobiotica. 2017 Oct;47(10):844-848. doi: 10.1080/00498254.2016.1247218.
434	In vitro and in vivo human metabolism and pharmacokinetics of S- and R-praziquantel Pharmacol Res Perspect. 2020 Aug;8(4):e00618. doi: 10.1002/prp2.618.
435	Biotransformation of praziquantel by human cytochrome p450 3A4 (CYP 3A4). Acta Pol Pharm. 2006 Sep-Oct;63(5):381-5.
436	Tumour cytochrome P450 and drug activation. Curr Pharm Des. 2002;8(15):1335-47.
437	Plasma kinetics of procarbazine and azo-procarbazine in humans Anticancer Drugs. 2006 Jan;17(1):75-80. doi: 10.1097/01.cad.0000181591.85476.aa.
438	Progesterone and testosterone hydroxylation by cytochromes P450 2C19, 2C9, and 3A4 in human liver microsomes. Arch Biochem Biophys. 1997 Oct 1;346(1):161-9.
439	Effect of selective serotonin reuptake inhibitors on the oxidative metabolism of propafenone: in vitro studies using human liver microsomes. J Clin Psychopharmacol. 2000 Aug;20(4):428-34.
440	Rapid and simultaneous extraction of propranolol, its neutral and basic metabolites from plasma and assay by high-performance liquid chromatography J Chromatogr. 1985 Oct 11;343(2):349-58. doi: 10.1016/s0378-4347(00)84603-4.
441	CYP450 phenotyping and metabolite identification of quinine by accurate mass UPLC-MS analysis: a possible metabolic link to blackwater fever
442	Management of postoperative nausea and vomiting: focus on palonosetron
443	Oxidation of ranitidine by isozymes of flavin-containing monooxygenase and cytochrome P450. Jpn J Pharmacol. 2000 Oct;84(2):213-20.
444	Pharmacokinetic interaction study between flavanones (hesperetin, naringenin) and rasagiline mesylate in wistar rats
445	A Single-center, Open-label, Parallel Control Study Comparing the Pharmacokinetics and Safety of a Single Oral Dose of Roflumilast and Its Active Metabolite Roflumilast N-oxide in Healthy Chinese and Caucasian Volunteers
446	Disposition of ropinirole in animals and man
447	Isolation and identification of major urinary metabolites of rifabutin in rats and humans
448	Lack of metabolic racemisation of ropivacaine, determined by liquid chromatography using a chiral AGP column
449	Metabolism and excretion of ropivacaine in humans
450	Regional transport and metabolism of ropivacaine and its CYP3A4 metabolite PPX in human intestine. J Pharm Pharmacol. 2003 Jul;55(7):963-72.
451	Effect of propofol on ropivacaine metabolism in human liver microsomes
452	Evaluation of absorption, distribution, metabolism, and excretion of [(14)C]-rucaparib, a poly(ADP-ribose) polymerase inhibitor, in patients with advanced solid tumors Invest New Drugs. 2020 Jun;38(3):765-775. doi: 10.1007/s10637-019-00815-2.
453	Pharmacokinetics and safety of rucaparib in patients with advanced solid tumors and hepatic impairment. Cancer Chemother Pharmacol. 2021 Aug;88(2):259-270. doi: 10.1007/s00280-021-04278-2.
454	A Phase 1 Study to Evaluate Absolute Bioavailability and Absorption, Distribution, Metabolism, and Excretion of Savolitinib in Healthy Male Volunteers
455	Interaction of sorafenib and cytochrome P450 isoenzymes in patients with advanced melanoma: a phase I/II pharmacokinetic interaction study. Cancer Chemother Pharmacol. 2011 Nov;68(5):1111-8.
456	Pharmacokinetics of stiripentol in normal man: evidence of nonlinearity
457	Pharmacokinetics, distribution, and metabolism of [14C]sunitinib in rats, monkeys, and humans
458	Cytochromes P450 1A2 and 3A4 Catalyze the Metabolic Activation of Sunitinib
459	Metabolism of tamoxifen by recombinant human cytochrome P450 enzymes: formation of the 4-hydroxy, 4'-hydroxy and N-desmethyl metabolites and isomerization of trans-4-hydroxytamoxifen. Drug Metab Dispos. 2002 Aug;30(8):869-74.
460	Metabolism and transport of tamoxifen in relation to its effectiveness: new perspectives on an ongoing controversy. Future Oncol. 2014 Jan;10(1):107-22.
461	Identification and biological activity of tamoxifen metabolites in human serum Biochem Pharmacol. 1983 Jul 1;32(13):2045-52. doi: 10.1016/0006-2952(83)90425-2.
462	PharmGKB summary: tamoxifen pathway, pharmacokinetics Pharmacogenet Genomics. 2013 Nov;23(11):643-7. doi: 10.1097/FPC.0b013e3283656bc1.
463	A multi-residue chiral liquid chromatography coupled with tandem mass spectrometry method for analysis of antifungal agents and their metabolites in aqueous environmental matrices. Anal Methods. 2021 Jun 14;13(22):2466-2477. doi: 10.1039/d1ay00556a.
464	Theophylline metabolism in human liver microsomes: inhibition studies. J Pharmacol Exp Ther. 1996 Mar;276(3):912-7.
465	Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants
466	New metabolites of thiabendazole and the metabolism of thiabendazole by mouse embryo in vivo and in vitro
467	Metabolism of ophthalmic timolol: new aspects of an old drug. Basic Clin Pharmacol Toxicol. 2011 May;108(5):297-303.
468	DrugBank(Pharmacology-Metabolism):Tizanidine hydrochloride
469	Total determination of triclabendazole and its metabolites in bovine tissues using liquid chromatography-tandem mass spectrometry J Chromatogr B Analyt Technol Biomed Life Sci. 2019 Mar 1;1109:54-59. doi: 10.1016/j.jchromb.2019.01.021.
470	Egaten FDA label
471	Pharmacokinetics, toxicological and clinical aspects of ulipristal acetate: insights into the mechanisms implicated in the hepatic toxicity Drug Metab Rev. 2021 Aug;53(3):375-383. doi: 10.1080/03602532.2021.1917599.
472	Comparative pharmacokinetics of vitamin K antagonists: warfarin, phenprocoumon and acenocoumarol. Clin Pharmacokinet. 2005;44(12):1227-46.
473	Indolealkylamines: biotransformations and potential drug-drug interactions
474	Determination of the human cytochrome P450 isoforms involved in the metabolism of zolmitriptan. Xenobiotica. 1999 Aug;29(8):847-57.
475	Zolpidem urine excretion profiles and cross-reactivity with ELISA(?) kits in subjects using Zolpidem or Ambien(?) CR as a prescription sleep aid
476	Norzotepine, a major metabolite of zotepine, exerts atypical antipsychotic-like and antidepressant-like actions through its potent inhibition of norepinephrine reuptake

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.